KEGG   Accumulibacter phosphatis: CAP2UW1_1852Help
Entry
CAP2UW1_1852      CDS       T00966                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
app  Accumulibacter phosphatis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CAP2UW1_1852
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CAP2UW1_1852
Enzymes [BR:app01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CAP2UW1_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2087486..2088931
Genome map
AA seq 481 aa AA seqDB search
MPRAVPRCWRSLLAWAALGSLLAVAWNLKHPLLYWLRPCETALLLAVAVLGGSAALRQPP
AQRSPGRRRLLALGLLALAGLTLWRELEFHADRRHVLAGGRDLQMLGEHFIVGFRSFAEV
EPLAARGLIGGIYLTRRNLLPDGVVTVAAGIAQLQEARRLAGLPPLIVAADQEGGPVAHL
SPWLERLPALSSLVHAAPPETLAVRARLHGERQGASLAALGVNLNLAPVVDLRPSEPNAA
LAFLTGSGGRAIDDDPAVVTEVARAYVAGLADAGVGATLKHFPGLARVREDTHLRRASLA
ATTEDLRGDWQPFRSVGNGSRVAIMLGHVVLQAVDPEHAVSHSRIVVQNVLRGQWGYRGV
LITDDLNMGAVYGQGIGRVAAQSLAAGVDLVLVSYDPDQYFRALSGAARALARGEIDRRT
LQASSRRLRAFGVARDGRGREPGSVAPTAAGAAGGSLAAIASPLTAVVDRADAAASPANR
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgctgtcccgcgttgctggcgctcgctgcttgcctgggcggcgcttggcagc
ctgctcgccgtcgcctggaatctcaagcatccgctgctgtactggctgcgcccctgcgag
acggctctgctgctggctgtcgccgtgctcggcggcagcgccgcgctgcggcagccgcct
gcgcagcgttcgcctggcaggcggcgactcctggcgctcggcctgctcgccctcgccggc
ctgaccctgtggcgagagctggagtttcacgccgatcgccggcacgtcctggccggtggc
cgcgacctgcagatgctgggcgagcatttcatcgtcggctttcgcagcttcgccgaggtc
gagccgctggcggcacgaggcctcatcggcggcatctacctgactcggcgcaacctcctg
cccgacggtgtggtgactgtcgccgccgggatcgcccagctccaggaagcccgtcgcctg
gccggcctgccgccgctgatcgtcgcggccgaccaggaaggcgggccggttgcccacctg
tcgccatggctggaacggctgccggcgctgtccagcctggtgcacgcggcgccgcccgag
acgctggcggtgcgcgcgcggctgcacggcgaacgacagggggccagcttggccgcactc
ggcgtcaatctgaatctggcgccggtggtggacctgcggccttcagaaccgaatgccgcc
ctcgctttcctgaccggcagcggcggccgggccatcgacgacgatccggcggtcgtcacc
gaggtggcccgggcgtatgtcgccggcctcgccgatgccggtgtcggcgccactctcaag
cactttccggggcttgcgcgggtgcgcgaggacacgcatctgcggcgcgccagtctggcg
gcgacaaccgaggatctgcgcggcgactggcagccgtttcgcagcgtcggcaacggctcg
cgggtggcgatcatgctcggccacgtggtcttgcaggcggtggaccccgaacacgcggtt
tcgcattcgcggatcgtcgtgcagaacgtcctgcgtgggcaatggggctatcgcggcgtg
ctgatcaccgacgatctcaacatgggcgccgtgtacggccagggaatcggtcgcgtcgcg
gcccagtcgctggcggccggcgtcgatctggttctcgtttcctacgaccccgaccagtat
tttcgtgcgcttagcggtgccgcccgggcactcgcccgaggcgagatcgaccggcggact
ctgcaggcaagcagtcggcgcctgcgcgcgttcggcgtcgcccgtgatgggcgtggccgg
gagcccggatccgtcgcgccaactgccgctggcgctgccggcggcagccttgccgccatc
gcatcaccgctaacggcggtggtcgacagagccgacgcggcagcttccccagcgaaccgg
ttgtag

DBGET integrated database retrieval system