KEGG   Accumulibacter phosphatis: CAP2UW1_1865Help
Entry
CAP2UW1_1865      CDS       T00966                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
app  Accumulibacter phosphatis
Pathway
app00521  Streptomycin biosynthesis
app00523  Polyketide sugar unit biosynthesis
app01130  Biosynthesis of antibiotics
Module
app_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CAP2UW1_1865
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CAP2UW1_1865
Enzymes [BR:app01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CAP2UW1_1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACV35164
JGI: CAP2UW11865
UniProt: C7RV85
Position
complement(2103966..2104508)
Genome map
AA seq 180 aa AA seqDB search
MKRIPTDLPDVWIVEPKVFGDARGFFMETWNRRTFADLGLDVEFVQDNHSRSRQGVLRGL
HYQIHEPQGKLVRVTSGEVFDVAVDLRRSSPHFGRWAGVTLSGENQRMLWVPPGFAHGFL
VVSPAADFLYKTTAYYAPEHERCVAWNDPDIGIRWPLDDEPALSAKDRIGTPLRLAEAYA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattccaaccgacctccccgatgtatggatcgtcgaaccgaaggtcttcggc
gacgcccgcggcttcttcatggaaacatggaaccgcaggacctttgccgatctgggtctg
gacgtggagttcgtccaggacaaccattcgcggtcccgccagggcgtactgcgcggactc
cactaccagatccacgaaccgcagggcaaactggtccgggtcaccagcggcgaagtgttc
gacgtggcagtggatctgcgcaggtcgtcgccgcattttggccgctgggcaggggtgacg
ctctccggcgagaaccagcgcatgctctgggttccgccaggctttgcccatggtttcctg
gtggtgtcgccagcagcagactttctgtacaagaccaccgcctactacgcaccggaacat
gagcgctgcgtcgcgtggaacgaccccgacatcggcatccgctggcccctcgatgacgag
cctgccctgtccgccaaggaccgtatcggaacccccctacggctggccgaagcctacgcc
tga

DBGET integrated database retrieval system