KEGG   Accumulibacter phosphatis: CAP2UW1_2118Help
Entry
CAP2UW1_2118      CDS       T00966                                 

Definition
(GenBank) diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s)
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
app  Accumulibacter phosphatis
Pathway
app02020  Two-component system
app02030  Bacterial chemotaxis
Module
app_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:app00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CAP2UW1_2118
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CAP2UW1_2118
Enzymes [BR:app01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     CAP2UW1_2118
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CAP2UW1_2118
Two-component system [BR:app02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CAP2UW1_2118
Bacterial motility proteins [BR:app02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CAP2UW1_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL CheB_methylest GGDEF CheR PAS_4 PAS_9 PAS PAS_10 PAS_8 CheR_N PAS_3 IncA THOC7 MscS_porin PAS_7 FapA Fez1 Rootletin Spc7 AIP3 IFT57 ATG16 DUF812 DUF2203 DUF3584 Rota_NSP3 Tmemb_cc2 DUF16 Atg14 AAA_13 Golgin_A5 LMBR1 APG6 TBPIP DUF4795 HMMR_N DUF1664 Mnd1 ERM
Motif
Other DBs
NCBI-ProteinID: ACV35414
JGI: CAP2UW12118
UniProt: C7RN47
Position
complement(2385462..2390090)
Genome map
AA seq 1542 aa AA seqDB search
MSIANEEQPRKKRTSAKKAPVAAEDDAHLVRVDERPFIVGVGASAGGLEALSLLLPSLPK
NLGLTYVVVQHLSPTYRSMMSQLLGRETTMTVRDIEDGMLPEPNMVYITPPNRNLTLKEG
HFRLVEPARESMPKPSVNRFFASLAEEVGESTIGIILSGTGSDGAAGIHAIKAAGGFTFS
QDPDTAKYNGMPQSAIDTGSVDWILPPEQMGAEISLIVLNRGLIPVATQAASAPATLKTL
LGKVRSRTKVDFSQYKEPTLWRRIERRMAANHVSTLHDYLQVVDQTPVELDKLCKDILIS
VTAFFRDTDAFSRLDKVVGEILAGKQPGDDIRVWVAGCATGEEAYSLAILFAERLGAAFD
QYRLQIFATDIDLDAMALARRGVFAASNLAHMERNRIRAHFTPHGDRYEINKSLRDAVIF
ARQDLVQDPPFLRLDLVSCRNVLIYFQSELQARLLSVFHYALNPGAFLFLGKSEGIFQQE
ALFGVVDKEARLYRRHGTSARLPLLRSEMQLPAAGLNQHQRPGKPITPQGFETILLEAAG
RHFIPTTILINGKFEIRHIHGDASRLLNVSPGRPAFDLISLIRRELRTEVQVLMRQAQVK
QTVVSGRPRHIKALDPTRGVRLSVHPVSDTGNEALFMLCIEWLLPPPGKTTVEDSGGIDE
KELEDELAATREHLQTLVEELETSNEEMQALNEEIQASNEEMQASNEELEASNEELQSTN
EELATVNEELQIKTAETQELNTELESIQNSVDYPLLVLDRNASLQRFNSAAARLFKLGAA
QTGRHLRDLPLPPDMPDLLADVQHVIDTQNARDRQIVNANRRHYALHIAPLLRDTQRIAG
VILLFADNTSLYEVERSARETQVRLQAVMNNSVSLMAVKDAPGRYQFANPKFEQTFGFAT
GEVIGKTDLQLFPEAVSDLFRESELEAIRLRKGIEREESLPLAAGERHFLVVRFPLFDDD
GAITGLCFQATDITARKRAEEQLRLAALVFDRASEGVMVTDTEQRILTINDSFSTLTGYT
RQEVVGKTPRLLRSDRMPREFYAEMWDKVTRLGVWQGEIWNRRKNGEPYLEWLSINTVKD
KNGKVVNYVGMFSDITKVRESQQRIEYLATHDELTGLPNRALFNDRLNLALAHAERSRES
VGVVFIDLDNFKVVNDTLGHETGDKLLKQAAMRLLECVRAEDTVARLGGDEFVVLLVNAD
RQQATLTAERLLTGLSTSYHFGEHECFISASIGLSMFPEDASDANSLMRNADSAMYRAKD
HGKNGFRFFSADLASQASKRLALETGLRRAIENGELFVHYQPQVRLECDTVVGAEALVRW
RYNGEVIDPVVFIPIAEQSHLIFAIDDWVLGEACRQIIEWDRAGLPPLRISVNISARHFR
KDGMAADLMDIVSAHGVSPQRLCIEITEGVLMDVDRAQRMLAELVESGLRISIDDFGTGF
SSLSYLKRFPIHELKIARSFVDGISTDADDRAIASVIISLARQLGMSVVGEGIERTGQHA
ELEAFGCHRGQGFLYAQPLAPDAFADWVLARTAKAADAKSIG
NT seq 4629 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgccaacgaagaacaacccaggaagaagcgcacgagcgcgaagaaggcgccg
gttgccgccgaagatgacgcgcacctggtgagagtcgatgaacgacccttcatcgtcggc
gtcggcgcgtcggccggtggtctcgaagcgttgagcctgctgctgccgagcctgccgaag
aacctcgggctcacttacgtcgtcgtccagcatttgtcaccgacctatcgcagcatgatg
tcgcagttgctggggcgcgagacgacgatgaccgtccgggacatcgaagacgggatgttg
cccgagccgaacatggtctacatcacgccgccgaatcgcaacctgacgctcaaggaaggg
catttccggctggtcgaaccagcgcgcgagtcgatgcccaagccatcggtcaatcgcttc
ttcgcctcgctcgccgaagaagtcggcgaatcgacgatcggcatcattctctccggcacc
ggctccgacggcgccgccgggatccacgcaatcaaggcggcgggcggtttcaccttctcc
caggatcccgacacggccaagtacaacggcatgccgcagtcggcaatcgacaccggcagc
gtggactggattctaccgccggagcagatgggtgccgaaatcagcctgatcgtcctcaac
cgcgggctgattccggtggcgacccaggcggcgagcgcgccggcgacgctcaagaccctg
ctcggcaaggtgcgcagccgcaccaaggtcgatttctcgcagtacaaggaaccgaccttg
tggcgccgcatcgagcggcgcatggccgccaaccatgtcagcaccctgcatgactacctg
caggtggtcgaccagacgccagtcgaactcgacaagctgtgcaaggacatcctgatctcg
gtcaccgccttcttccgcgacaccgacgcgttctcgcgcctcgacaaggtggtcggcgag
attctcgccggcaagcagcccggtgacgacatccgcgtctgggtcgccggctgcgcgacc
ggtgaggaggcgtattcgctggccatcctgttcgccgaacggctgggcgccgccttcgac
cagtatcgcctgcaaatcttcgccaccgatatcgacctcgacgcgatggctttggcgagg
cgcggcgtgtttgccgcgtccaacctcgcgcacatggagcgcaaccgcatccgcgcccat
ttcacgccgcatggcgaccgctacgagatcaacaagagcttgcgcgatgcggtgatcttc
gcgcgccaggatctggtgcaggacccgcccttcctgcgcctcgatctggtcagttgccgc
aacgtcctgatctacttccagagcgagttgcaggcgcgcctgctgtcggtgttccactac
gcgctcaacccgggtgccttcctgttcctcggcaaatcggagggtatcttccagcaggaa
gcgctgttcggggtcgtcgacaaggaggcccgactctatcgtcggcacggcaccagcgcc
cgactgccgctgctccgttcggaaatgcagctcccggccgccggcctcaaccagcatcag
cgaccgggcaagccgattacgccgcagggcttcgaaacgatcctgctcgaggcggctggc
cgccatttcatcccgacgacgatcctgatcaacggcaagttcgagatccgccacatccat
ggtgacgccagccggctgctcaacgtgtcgccagggcgaccggctttcgacctgatctct
ctgatccgtcgcgagctgcgtaccgaagtccaggtgttgatgcgccaggcgcaggtcaaa
cagaccgtcgtcagcggccgtccccggcacatcaaggcactcgacccgacgcgcggcgtt
cgcctctcggttcacccggtctcggacaccggcaacgaggccctgttcatgctctgtatc
gagtggcttctgccaccgcccggcaagacgacggtcgaggacagcggcggcatcgacgag
aaggaactcgaggacgaacttgccgcgacgcgcgagcatctgcagacgctggtcgaggaa
ctggagacgtcgaacgaggaaatgcaggcactgaatgaggagattcaggcctcgaacgag
gaaatgcaggcgtcgaacgaagaactcgaagcgtcgaacgaggagcttcaatcgacgaac
gaggaactggcaacggtcaacgaagagctgcagatcaagaccgccgagacgcaggaactc
aacaccgaactggagagcatccagaacagtgtcgactacccgctgctggtgctcgaccgg
aacgcttcgctgcagcgtttcaacagcgccgccgctcgcctgttcaagctcggtgcggcg
cagacgggacgccacctgcgcgacctgccgctaccacccgacatgccggatctcctggcc
gacgtccagcacgtgatcgacacccagaacgcccgcgatcgccagattgtcaacgccaac
cggcgccattacgcgctgcacatcgcgccgcttttgcgcgacacgcagcggatcgccggc
gtcattctgctgttcgccgacaacaccagcctctacgaagtcgagcgctcggcgcgcgaa
acgcaggtcaggttgcaggccgtgatgaacaactcggtgtcgctgatggcggtgaaggac
gctcccgggcgctaccagttcgccaacccgaagttcgaacagactttcggtttcgctact
ggcgaggtgatcggcaaaacggatctgcaacttttcccggaagccgtatccgatctcttc
cgcgagagtgaactcgaggcgatacgtctgcgcaagggaatagagcgcgaagaatccctg
ccgctggcggctggcgaacgccacttcctggttgtccgctttccgcttttcgacgacgac
ggagcgattaccggcctgtgcttccaggccaccgacatcaccgcccgcaagcgcgccgag
gagcagttgcggctggccgcactggtcttcgaccgcgcttcggaaggcgtcatggtgacg
gataccgagcagcgtatcctgaccatcaatgattcgttttcgaccctcaccggctacacg
cggcaggaggtggtcggcaagactccccgtctgctgcgctctgacaggatgccgcgcgag
ttctatgccgagatgtgggacaaggtcactcgcctcggtgtctggcagggtgagatctgg
aaccgccggaaaaacggcgagccttacctcgaatggctgtcgatcaatacggtcaaggac
aagaacggcaaggtggtcaactatgtcggcatgttcagcgacatcaccaaggtgcgcgag
tcgcagcagcgcatcgagtatctcgccacccacgacgaattgaccgggctacccaaccgc
gcgctcttcaatgatcgtctgaacctggcgctggcccatgccgagcgctcgcgcgagagc
gtcggtgtggtgttcatcgacctcgacaacttcaaggtggtcaacgacacgcttggtcac
gagaccggcgacaagctgctcaagcaggccgccatgcgcctgcttgaatgcgtgcgtgcc
gaagacaccgttgcccgactgggcggcgacgaattcgtcgtcctgctggtcaatgccgac
cgtcagcaggcaacgctgaccgccgaacgcctgctgaccgggctgagcaccagctaccat
ttcggcgagcacgaatgcttcatcagcgccagcatcggcctgagcatgttccccgaggat
gccagtgatgccaattccctgatgcgcaacgccgactcggcaatgtatcgggcgaaggat
cacggcaagaacggtttccgctttttctccgccgatctggccagccaggccagcaagcgc
ctggccctggagactggcctgcggcgggccatcgagaacggcgagttgtttgttcattac
cagccacaggtcaggctcgagtgcgatacggtagtcggcgccgaggcgctcgtgcgctgg
cgttacaacggtgaagtgatcgacccggtagtgttcattccgatcgcggagcaaagccac
ctgatcttcgccatcgacgactgggtacttggcgaggcctgtcgccagatcatcgagtgg
gacagggccggactgccgccgctgcggatcagcgtcaacatctcggcgcgccatttccgc
aaggacggcatggcggctgacctgatggacattgtcagcgcccacggagtttcgccgcag
cgtctgtgcatcgagatcaccgagggcgtgctcatggacgtcgatcgtgcgcagcgcatg
ctggccgaactggtcgagtccgggttgcggatcagcatcgatgacttcggcaccggcttc
tcctcgctgtcctacctcaagcgttttccaattcatgaactaaagatcgcccgcagcttc
gtcgacggcatctcgacggatgccgacgaccgcgcgatcgcttcggtgatcatctcgctg
gcgcgacaactcgggatgagcgtggtcggcgagggaatcgagaggactggccagcacgcc
gagctcgaagcgtttggctgccatcgcggccagggctttctctatgcccagccgctggcg
ccagacgccttcgccgactgggtgctcgcccgcactgccaaggcagccgatgccaaaagc
atcggatga

DBGET integrated database retrieval system