KEGG   Accumulibacter phosphatis: CAP2UW1_2247Help
Entry
CAP2UW1_2247      CDS       T00966                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
app  Accumulibacter phosphatis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAP2UW1_2247
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_2247
   00620 Pyruvate metabolism
    CAP2UW1_2247
   00640 Propanoate metabolism
    CAP2UW1_2247
  Energy metabolism
   00680 Methane metabolism
    CAP2UW1_2247
Enzymes [BR:app01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CAP2UW1_2247
Lipid biosynthesis proteins [BR:app01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CAP2UW1_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2553846..2555522)
Genome map
AA seq 558 aa AA seqDB search
MSYSAFVQARDFLQAHRTDYETAYRDYQPPQLTEFNWALDYFDVMAKGNDRPALWVVNED
GSEQKMSYSQMSQRSNQVANWLRGQGVKRGDRILMMLGNEVPLWDTMLAAIKLGAVLTPA
TTLLAPDDLRDRLDRGQVRHVIIGHTHTDKFTSLPGDYTRTTVGGAVAGWQQLEQAYQES
TDFAPDGPTLATDPQLLYFTSGTTSKPKLVLHSQQSYPVGHLSTMYWLGLQPGDVHWNIS
SPGWAKHAWSCFFAPWNAGATIFIFNYSRFTAAAILETLVRCSVTTLCAPPTVWRMLIQE
DLRKYPVKVRELIGAGEPLNPEVIDQVKEAWGITLRDGFGQTETTAQVGNSPGQPVKLGS
MGRPMPGYQVRLVDMDGHVAEEGEICLDLASRPIGLMISYADDPEKTAEVMRDGFYHTGD
TAAIDADGYITYVGRADDVFKASDYRISPFELESVLIEHEAVAEAAVVPSPDALRLAVPK
AFLTLRAGYEPSRELARDIFVFLRSRLSPYKRVRRLEFGELPKTISGKIRRVELRKGEQD
RGAAPRGALEFYEEDFEF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtcttattcggctttcgtccaggcacgcgatttccttcaggcgcaccgcacggactac
gagaccgcgtatcgggattaccagccgccgcagttgaccgagttcaactgggcgctggac
tacttcgacgtgatggcgaagggcaacgaccggccggcgctgtgggtggtgaacgaggac
ggctcggaacagaagatgtcctattcgcaaatgtcgcagcgctcgaaccaggtcgccaac
tggctgcgcggccagggcgtcaagcgtggcgatcgcatcctgatgatgctcggcaacgaa
gtaccgctgtgggacacgatgctggcggcgatcaagctcggcgcggtattgacgccggca
acgacgctgctcgctcccgacgacctgcgcgaccgcctcgaccggggtcaggtgcggcac
gtgatcatcggccacacgcacaccgataaatttaccagcctgccgggcgactacacgcgc
acgacggtcggcggggcagtggcgggctggcagcagctcgaacaggcctaccaggagtcg
accgacttcgcccccgacgggccgacgctggctaccgatccgcaactcctgtacttcacc
tcgggcaccacctcgaagccgaaactggtgctgcacagccagcagagctatccggtcggg
cacctgtcgacgatgtactggctggggctgcaacccggcgacgtgcactggaacatcagc
tcgccgggctgggccaagcatgcgtggagctgctttttcgcgccctggaacgccggtgcg
acgatcttcattttcaactactcgcgcttcacggcggcggcaatcctcgagacgctggtc
cgctgctcggtgacgacgctgtgcgcgccgccgacggtgtggcggatgctgatccaggaa
gacctgcgcaagtatccggtcaaggtgcgcgaactgatcggcgccggtgagccgctcaat
ccggaagtcatcgaccaggtcaaggaagcatggggaatcaccttgcgcgacggtttcggg
cagaccgaaacgacggcacaggtcggcaactcgcctggccagccagtcaagctcggttcg
atgggtcggccgatgccgggctatcaggtgcgcctggtggacatggacggccatgttgcc
gaggaaggtgaaatctgtctcgacctcgcgtcgcggccgatcggactgatgatttcctat
gccgacgatcccgaaaagaccgccgaggtgatgcgggacggcttctatcacaccggcgat
accgcggcgatcgacgccgatggctacatcacctatgtcggacgcgccgacgatgtcttc
aaggcttccgactatcgcatcagcccgttcgaactcgaaagcgtgctgatcgagcacgaa
gcggttgcggaagccgccgtcgtgccgagtccggacgccctgcgcctggcggtcccgaag
gccttcctcaccctgcgcgccggctacgagccgagccgcgaactggcgcgcgacatcttc
gtcttcctgcgcagccgtctgtcgccttacaaacgcgtgcggcgactggagttcggcgaa
ctgccgaagaccatctcgggcaagattcgccgcgtcgaactacgcaagggagagcaggac
cgtggtgccgcaccgcgtggcgcgctcgagttctacgaggaagacttcgagttctga

DBGET integrated database retrieval system