KEGG   Accumulibacter phosphatis: CAP2UW1_2336Help
Entry
CAP2UW1_2336      CDS       T00966                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
app  Accumulibacter phosphatis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CAP2UW1_2336
Enzymes [BR:app01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CAP2UW1_2336
Exosome [BR:app04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAP2UW1_2336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2678615..2680126)
Genome map
AA seq 503 aa AA seqDB search
MAATTREQFVLALDQGTTSSRAIVFARDGSIRALAQQEYTQHYPQPGWVEHDANDIWQTQ
LAVARAVLRDSGIAASQIAAVGLTNQRETTVLWDRASGEPLHRAIVWQDRRTAGLCDSMA
RAGHAELFGQRTGLVLDAYFSGTKLKWLLDHIPGARARAERGELAFGTIDSWLAWKLSGG
RVHVTDPSNASRTLLYDIRRLRWDDELLALLDVPPAVLPRVVDSSGVVGLLASDLLGAPI
PLAGIAGDQQAATYGQACLEPGMAKNTYGTGCFLLLNTGARAMNSAHRMLTTIGWRRLGQ
TTYLLEGSVFMGGAAVQWLRDGLAMISRSDEIEALAASVPDTGGVYLVPAHTGLGAPYWD
PYARGALLGMTRGTTRAHIARATLEAIAFQSAEVLRAMELDAGERLRELRVDGGGGANDL
LLQFQADLLGVPVVRPRVTETTALGAAYLAGLAVGFWQDEAELASLWRAERRFEPAMSDA
QRTALLGGWRRAVQRCLHWAIAD
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaccacccgcgaacaattcgttctggcactcgaccaggggacgaccagttcg
cgcgccatcgtcttcgcacgcgacggcagcatccgcgcgctcgcccaacaggagtacacc
cagcactatccgcaacccggctgggtcgagcacgacgccaacgatatctggcagacacaa
ctcgccgtggcacgtgccgtgttgcgcgacagtggcatcgcggccagccagatcgccgcc
gtcggtctcaccaaccagcgcgagacgaccgttctctgggaccgggccagcggcgaaccc
ctgcaccgggccatcgtctggcaggaccggcggaccgccggactctgcgattccatggcg
cgagcgggtcatgccgagctgttcggccagcgcaccgggttggtcctcgacgcctacttc
tccggaaccaagctgaaatggctgctcgatcacatccccggcgcgcgcgcccgcgccgag
cgcggcgagctcgctttcgggacgatcgatagctggttggcgtggaagctgtcgggcggc
cgggtgcacgtcactgatccgtcgaacgcctcgcgcacgctgctctacgacatcaggcgc
ctgcgctgggatgacgaactgctggccctgctcgatgtcccgccggccgtgttgccgcgg
gtcgtcgacagcagcggcgtcgtgggcttgctggccagcgacctgctcggcgccccgatc
ccgctggccggcatcgccggcgaccagcaggcggcgacctacgggcaggcctgcctggaa
ccgggcatggccaagaatacctacgggaccggctgtttcctgctgctcaacaccggtgca
cgggccatgaactcggcgcaccggatgctcacgacgatcggctggcggcgcctcggacag
accacttacctgctcgaaggcagcgtattcatgggtggcgccgcggtgcaatggctgcgc
gacgggctcgcgatgatttcccgctcggacgagatcgaagcactggcggcctcggtaccc
gacactggcggcgtctatctggtccccgcccacaccgggctcggcgccccgtactgggat
ccctatgcgcgcggcgccctgctcggcatgacgcgcggtacgacccgggcgcacatcgcc
cgcgcgacgctcgaagcgatcgcctttcagagtgccgaggtattgagggcgatggaattg
gatgccggcgagcgtctgcgcgagttgcgcgtcgacggcggcggcggcgccaacgatctg
ctgctgcagtttcaggccgacctgctcggcgtgccggtggtccgtcccagggtcaccgag
acaacggcgctcggcgccgcctacctcgccggactggccgtcggattctggcaggacgag
gccgagctcgcttccctgtggcgcgccgagcgccgcttcgaacccgcaatgtcggatgca
cagcgtacagccctgctcggcggctggcggcgcgctgtccagcgttgtctgcactgggca
atcgccgactga

DBGET integrated database retrieval system