KEGG   Accumulibacter phosphatis: CAP2UW1_2389Help
Entry
CAP2UW1_2389      CDS       T00966                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
app  Accumulibacter phosphatis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAP2UW1_2389
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAP2UW1_2389
  Amino acid metabolism
   00310 Lysine degradation
    CAP2UW1_2389
Enzymes [BR:app01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CAP2UW1_2389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2744378..2745640
Genome map
AA seq 420 aa AA seqDB search
MIIDVKVPQLSESVAEATLVSWHKRAGEAVVRDENLIDIETDKVVLELPAPDAGVLVEIV
KGDGDTVVSGEVIARIDTAAQAGAVAAPAAKTAPAQPEAAAAAAATAAGTALPAARKILD
EKGIAAADVAGTGRGGRVTKSDALAAQAPAIQVPAARPVASAASVAAPSTGAAPALAPAP
AVTVPLGDRPEQRVPMSRLRARVAERLLQSQATNAILTTFNEVNMGPIMALRKQYADRFE
KAHGVRLGFMGFFVKAAVAALQKFPVINASVDGNDIVYHGYIDIGIAVGSPRGLVVPILR
DADQMTIADIEKKIGEFGAKAKDGKLSMEDLTGGTFSISNGGVFGSMLSTPIINPPQSAI
LGIHATKDRPVVENGQIVIRPINYLAMSYDHRIIDGREAVLGLVTMKEALEDPARLLLGV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgacgtcaaagttccacagctttccgaatcggtcgctgaagcgacactggtt
tcgtggcacaagagggcgggcgaagccgttgtgcgggatgagaacctgatcgacatcgag
accgacaaggtcgtcctcgaactgccggcaccggatgctggcgtgctggtggagatcgtc
aagggcgatggcgatacggttgtctcgggcgaggtcattgcgcgtatcgacactgcggcc
caggctggcgccgtcgcagcaccagccgccaagacggcacccgcgcaacccgaagccgca
gcggcagccgccgcgacggcggcgggtaccgccttgccggcagcgcgcaagatcctcgac
gagaagggcatcgccgccgccgatgttgctggtaccggacgtggcggccgggtgaccaag
tcggatgcgctggccgcacaggcgccggcaatccaggttccggcggccaggccggtggcc
agcgccgcgtcggtggctgcaccgtccaccggcgccgctcccgccctggcaccggcacct
gccgtgaccgtgcctttgggcgaccgccccgagcaacgcgtgccgatgtcgcgcctgcgc
gcgcgcgttgccgagcgcctgctgcagtcgcaggcaaccaacgcgatcctgaccacgttc
aacgaagtgaacatgggtccgatcatggcactgcgcaagcagtacgctgatcgcttcgag
aaagcgcatggcgtgcgtctgggtttcatgggtttcttcgtcaaggcggccgtcgccgca
ctgcagaagttcccggtgatcaacgcttcggtggatggcaacgacatcgtctatcacggc
tacatcgacatcggtatcgccgtcggcagtccgcgcggtctggtcgtaccgatcctgcgc
gatgcggatcagatgaccattgccgatatcgagaagaagattggcgagttcggggcgaag
gccaaggacggcaagttgtcgatggaggatctgacgggcggcaccttctcgatctcgaac
ggcggcgtttttggctcgatgctgtcgacgccgatcatcaacccgccgcagtcggcgatc
ctcggcatccacgccaccaaggaccgtccggtcgtcgagaatggccagatcgtgattcgc
ccgatcaattatctggcgatgtcctacgaccatcgcatcatcgacggtcgcgaggcggtg
ctgggtctcgtaacgatgaaggaggcgctggaagatccagctcgcctgctgctcggcgtt
taa

DBGET integrated database retrieval system