KEGG   Accumulibacter phosphatis: CAP2UW1_2455Help
Entry
CAP2UW1_2455      CDS       T00966                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
app  Accumulibacter phosphatis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CAP2UW1_2455
Enzymes [BR:app01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CAP2UW1_2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2824494..2825018)
Genome map
AA seq 174 aa AA seqDB search
MPGTRRWSNVASSSHLAFVALGANLDDPLAQVRAAGDALAGVPESRLLYLSSLYRTAPVG
IRGQPDFINAVAALTTELAPLRLLDALFSVERRFGRRREFHQAPRTLDLDLLLYDQLIVD
SPRLSLPHPRMHLRAFVIAPLLEIAPHCHIPGRGSAAAWLPAVSMQRIERVPTQ
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtacgcgccgatggtccaacgtggctagttcgtcacacctggctttcgtcgct
ctcggggccaacctcgacgacccgttggcgcaagtgcgcgcggcgggcgatgcgctcgcc
ggcgtacccgaatcccgtctgctgtacctgtcctcgctttaccgcacggcgccggtggga
atccgcggccagcccgatttcatcaatgccgtcgccgccctgacgaccgaactggcaccg
ctgcgacttctcgatgcgctgttctcggtcgaacgccgctttggtcgtcgccgcgagttc
caccaggcaccgcgcaccctcgacctcgacctgctgctctacgatcaactcatcgtcgat
agcccacggctgagcctgccgcacccgcgcatgcacttgcgcgccttcgtcatcgcgccc
ttgctcgagatcgcgccgcactgccacatcccgggtcgcggcagcgccgcggcctggcta
ccggcggtgagcatgcaacgcatcgaaagagtgccgactcaatag

DBGET integrated database retrieval system