KEGG   Accumulibacter phosphatis: CAP2UW1_2511Help
Entry
CAP2UW1_2511      CDS       T00966                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
app  Accumulibacter phosphatis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAP2UW1_2511
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_2511
   00020 Citrate cycle (TCA cycle)
    CAP2UW1_2511
   00620 Pyruvate metabolism
    CAP2UW1_2511
   00640 Propanoate metabolism
    CAP2UW1_2511
   00650 Butanoate metabolism
    CAP2UW1_2511
  Energy metabolism
   00680 Methane metabolism
    CAP2UW1_2511
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CAP2UW1_2511
Enzymes [BR:app01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CAP2UW1_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2895052..2896305
Genome map
AA seq 417 aa AA seqDB search
MLKQTEGSHAVAEAVGLCRPEVICAYPISPQTHIVEGLGEMVKAGEIQDCEFINVESEFA
AMSVAIGSSATGARTYTATASQGLLFMAEAVYNASGLGLPIVMTVANRAIGAPINIWNDH
TDALSQRDSGWIQLFAETNQEALDLHIQAFKLAEEVSLPVMVCMDGFILTHAYERVDVPT
QEQVDAFLPPYEPRQVLDPTDPVSIGAMVGPEAFSEVRYLAHAKQMQALELIPRLAEQFK
AVFGRDSGGLTHSYLLDDAETVVVAMGSVLGTIKDTVDEMRAAGEKIGVLGITSYRPFPL
DNVRAALQNAQRVVVLEKSLAVGIGGVLSTDVRMAMSGLQLHGHTVVAGLGGRAITRKSL
RALFAKAVRGELGHLTFLDLDWNVVNKQLERERTTRRSGPAAESMLRDIGVIATGIV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaacagactgaaggttcacacgctgttgccgaagccgtcggcctttgccggcca
gaagtgatctgcgcctatccgatctctccgcagacgcacatcgtcgaaggcctcggtgaa
atggtcaaggccggcgaaatccaggactgcgagttcatcaacgtcgaatccgagttcgcg
gcgatgagtgtcgccatcggatcgtcggcaacaggcgcccgtacctacacggccacggcc
tcgcagggcctgctgttcatggccgaggcggtatacaacgcgtccggccttggcctgccc
atcgtcatgacggtcgccaaccgggccatcggcgcaccgatcaacatctggaacgaccac
accgatgcgctctcgcaacgcgacagcggctggatccagcttttcgccgaaaccaatcag
gaagcgctggatttgcacatccaggccttcaagctggcggaggaagtcagcctgccggtc
atggtctgcatggacggattcattctgacgcacgcctacgagcgcgtggacgtaccgacc
caggaacaggtcgatgccttcctgccgccttacgagccacgtcaggttctcgacccgacc
gacccggtatcgatcggcgcaatggtcggtccggaagcgttctcggaggtgcgctacctg
gcgcacgccaagcagatgcaggctctcgaactgatcccgcgattggccgagcagttcaag
gcggtcttcggtcgcgattcaggcgggctgacccattcgtacctcctcgacgatgcagaa
acggtggttgtggcgatggggtcggtgctcggaacgatcaaggatacggttgacgagatg
cgtgctgccggcgagaagatcggcgtgctcgggatcacttcctatcgtccgttcccgctc
gacaacgtccgcgccgcgctgcagaacgcgcagcgcgtggtcgtgttggaaaagagtctg
gcggtcggcatcggtggcgttctctccaccgacgtacgcatggcaatgtcgggtctgcaa
ctgcatggacacacggtggtcgccggccttggtggccgggcaatcacccggaaatcgttg
cgtgctctgtttgccaaggcagttcgcggcgaactgggccacctcaccttcctcgacctc
gactggaacgtcgtcaacaagcaactcgaacgcgagcgcacgacgcgccgttcgggtccg
gcagcggaaagcatgctgcgcgacatcggtgtcattgccaccggtattgtctga

DBGET integrated database retrieval system