KEGG   Accumulibacter phosphatis: CAP2UW1_2512Help
Entry
CAP2UW1_2512      CDS       T00966                                 

Definition
thiamine pyrophosphate TPP-binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
app  Accumulibacter phosphatis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAP2UW1_2512
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_2512
   00020 Citrate cycle (TCA cycle)
    CAP2UW1_2512
   00620 Pyruvate metabolism
    CAP2UW1_2512
   00640 Propanoate metabolism
    CAP2UW1_2512
   00650 Butanoate metabolism
    CAP2UW1_2512
  Energy metabolism
   00680 Methane metabolism
    CAP2UW1_2512
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CAP2UW1_2512
Enzymes [BR:app01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CAP2UW1_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2896317..2897330
Genome map
AA seq 337 aa AA seqDB search
MSFQPVHFYQTGTFTVGNRLLAQEERSVQANMERTNSLNSGHRACQGCGEALGARYAIDA
AMKAASGRLIAANATGCLEVFSTPYPETSWQIPWIHSLFGNTAAVATGIAAAIKVKRHKG
QMGDVRVVAQGGDGGTTDIGFGCLSGMFERNDDVLYICYDNGGYMNTGVQRSSATPPAAR
TATTMPVGPEPGNAFGQGKFVPAIAMAHEIPYVATATVADLRDLEYKVTKAMGMRGARYI
HILVPCPLGWGAASEDTIKLARLAKETGIFPVFEAEGGELTSSLKIRRQQPVEEYLKLQK
RYAHLFGKTPAVATIARLQAAADKNIRKYGLLDQEAN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagcttccaacccgttcatttctatcagaccggcaccttcacggtcggtaatcgcctg
ctggctcaggaagaacgcagtgtccaggccaacatggaacgtaccaattcactcaactcc
ggacaccgtgcctgtcagggctgcggtgaagcgcttggcgctcgctatgccattgacgcc
gcgatgaaagccgccagcggtcgcctgattgccgccaatgctaccggttgcctcgaggtc
ttctcgacgccctacccggaaacttcgtggcagatcccctggatccactcgctgttcggc
aacacggcggcggtggccaccggcatcgccgcagccatcaaggtcaagcgccacaaaggc
cagatgggcgatgttcgcgtcgtcgcccagggtggtgacggggggaccacggacatcggt
ttcggctgcctgtcgggaatgttcgaacgtaacgacgacgttctctacatctgctacgac
aacggcggttacatgaacaccggcgtccagcgcagttccgccaccccaccagcagcccgc
acagcgaccaccatgccggtcggccccgagccgggcaatgccttcgggcagggcaagttc
gtgccggcgatcgccatggcccacgagatcccctatgtcgcgaccgccaccgtcgccgac
ctccgcgatctcgaatacaaggtcaccaaagcgatgggaatgcgcggtgcgcgctacatc
cacatcctggtcccctgcccgctcggttggggagcggcctccgaagacaccatcaagttg
gcgcgtctggccaaggaaaccggtattttcccggtcttcgaagcggagggcggcgaactc
acgagttcgctcaagatccgccgccagcagcctgttgaagagtatctgaaactccagaag
cgctacgcgcacctgttcggcaagacgccggcggtagcaacgatcgctcgcctgcaggcg
gcggcagacaagaacattcgcaaatacggactgctcgaccaggaggcgaactga

DBGET integrated database retrieval system