KEGG   Accumulibacter phosphatis: CAP2UW1_2552Help
Entry
CAP2UW1_2552      CDS       T00966                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
app  Accumulibacter phosphatis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CAP2UW1_2552
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CAP2UW1_2552
Enzymes [BR:app01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CAP2UW1_2552
Lipid biosynthesis proteins [BR:app01004]
 Desaturase
  First
   CAP2UW1_2552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2940282..2941445)
Genome map
AA seq 387 aa AA seqDB search
MYAGIVDWPWWAYVLTTLALTHVTIAAVTIFLHRHQAHRALDLHPLVAHFFRLWLWLSTG
MVTKEWAAIHRKHHAKCETAEDPHSPQVFGINRVLWGGVFLYVKEARNGDTLQRYGRGTP
DDWLENHLYSPWHKLGIVIMLAIDVAIFGVFPGVLIWLVQMLWIPFWAAGVINGLGHFWG
YRNFNSPDASTNLFPWGILIGGEELHNNHHTFATSARLSNRWYEFDVGWLYIRILAALRL
AHIKKVAPRPRLGTLRPVVDFDTLQAVIANRYDVLSRYAKSLKQVYREELDRLQDGNRFK
GLKRWLAADAGAVPQEMRGRLESLLGESRALETAYAMRQELAAVWERSNASREQLLQALQ
DWCERAENSGVRQLQELSMRLRSYALA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgggaatagtcgattggccctggtgggcatacgtattgaccacactggctctg
acgcacgtgaccattgctgcggtgaccatttttctgcaccgtcatcaggcgcaccgtgcc
ctggatctgcatccgctggtcgcgcattttttccgcctctggctgtggctgagcaccggg
atggtgaccaaggagtgggcggccatccaccgcaagcatcacgccaagtgcgagactgcc
gaggatccgcacagcccgcaggttttcggcatcaaccgggtgctctggggtggcgtcttc
ctttacgtcaaggaggccaggaacggtgacaccctgcagcgctacggtcgggggacgccg
gacgactggctcgagaatcatctgtactcgccatggcacaagctcggtatcgtgatcatg
ctggccatcgacgtggcgatcttcggcgtgtttccaggggtgctgatctggctggtgcag
atgctctggattccgttctgggcggccggggtgatcaacggtctcggccatttctggggc
taccgcaacttcaattcccccgacgccagcaccaacctcttcccctggggaatcctcatc
ggcggcgaggaactgcacaacaaccatcacaccttcgccacgtcggcgagattgtcgaac
cgctggtacgaattcgacgtcggttggctctacatccgcatcctggcggcgctgcgcctg
gcgcatatcaagaaggtggcgccccggccgcgactcggcaccctgcgcccggtggtggat
ttcgacactttgcaggcggtgatcgccaaccgttacgacgtcctttcgcgctatgccaag
tcgctcaagcaggtctatcgcgaagaactcgacagattgcaggacggcaatcgcttcaag
ggcctcaagcgctggctggccgccgacgccggtgccgtgccgcaggaaatgcgcggacgg
ctggaatcgctgctcggcgagagtcgggcactcgaaacggcttacgccatgcgccaggaa
ctggcagcggtctgggaacgttcgaatgcgtcgcgcgagcaactgctgcaggctctgcag
gactggtgcgagcgtgccgagaactcgggagttcggcaactgcaggaactgtcgatgcgc
ttgcgcagctatgcgctggcctga

DBGET integrated database retrieval system