KEGG   Accumulibacter phosphatis: CAP2UW1_2721Help
Entry
CAP2UW1_2721      CDS       T00966                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
app  Accumulibacter phosphatis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CAP2UW1_2721
Enzymes [BR:app01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CAP2UW1_2721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3150052..3150696)
Genome map
AA seq 214 aa AA seqDB search
MDELRRQLIATAQRTDGLGLGRGTAGNLSVRTEGGEAAGFLITPSGMPSAALVAKDIVFM
RFDGTSVGCRKPSSEWRFHRDIYVSRPDAGAVLHAHPPFATSVACLRRDIPAFHYMLARF
GGDTLRCAAYATFGTQALSDAVLLAMADRRACLLANHGMLVFGDDLTHALALGVELEALC
EQYWRACQLGQPVLLDAAEMATVLDRFASYGQQV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcttcgccggcagttgatcgcgaccgcgcagcgcacggatggccttgggctg
ggacggggcacggcgggcaacctcagcgttcgcaccgagggcggcgaagcggcgggcttt
ctgatcacccccagcggcatgccgagcgcagctctggttgccaaggacatcgtcttcatg
cgtttcgacggaacgtccgtgggatgtcgcaagccctcgtccgagtggcgctttcatcgt
gacatctatgtctcccggcccgacgcgggcgccgtcctgcatgcgcacccgcctttcgcc
accagtgtggcttgcctgcgccgcgacattccggcctttcactacatgctggcgcgcttt
ggcggggacactctgcgctgcgcggcttacgcgactttcggcacgcaagcgctctcggac
gccgtgttgctggcgatggccgatcgtcgcgcctgtctgcttgccaaccacggcatgctg
gtgttcggcgacgacctgacgcacgccctggcccttggcgtcgaactcgaggcactgtgc
gaacagtactggcgcgcctgtcaactcggtcagccggtgctgctcgatgcggcagagatg
gcgacggtgctcgacaggttcgccagctacggccaacaggtctga

DBGET integrated database retrieval system