KEGG   Accumulibacter phosphatis: CAP2UW1_2733Help
Entry
CAP2UW1_2733      CDS       T00966                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
app  Accumulibacter phosphatis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:app00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3162041..3162901
Genome map
AA seq 286 aa AA seqDB search
MPTPEETWNWQSAYPAPAKLNLFLHVVGRRADGYHLLQTVFRFLGHGDSLRFAPRADGAV
HLATPLPGVPPENDLTVRAARLLQAATGCRAGVEISIDKRLPLGGGLGGGSSDAATVLLA
LNHLWQLALPRRRLQEIGLQLGADVPVFVFGRNAFAEGIGETLRPVELPPSWYVVLEPPV
QVPTAAIFGSPELKRDSRPIAVDAWRPAFGTNDLEAVACARFPVIAEHLAWLATWAPARM
SGSGACVFAEFATLDMAATTLAQLPATMRGWLAPGLDHHPLRALAD
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccgacacctgaagagacatggaactggcagagcgcatacccggcgccggccaagctc
aacctttttctccacgtcgtcggccgacgcgcggatggctaccacctgctgcagaccgtc
tttcgctttcttgggcatggcgacagcctgcgcttcgcgccacgtgccgacggcgcggta
cacctggcgacgccactgcccggggtgccgccggaaaacgacctgacggtgcgtgccgcg
cgcctgctgcaggcggcaaccggttgccgggccggcgtcgaaatcagcatcgacaagcgt
ctgccgctcggtggcggcctgggtggcggaagctcggatgccgcgacggtcttgctggcc
ctcaaccacctctggcagcttgctctgccgcgccgccggctgcaggaaatcggcctgcag
cttggcgccgacgtgccggtattcgtcttcggccgcaacgcctttgccgaaggcatcggc
gagacgctgcgaccggtcgagttgccgccgagctggtacgtggtcctcgaaccgccggtg
caggtgccgacggcagcgattttcggcagccccgaactcaagcgcgattcacggccgatt
gccgtcgatgcctggcgtccggccttcggcaccaatgacctcgaagccgtggcatgcgct
cgctttccggtgattgccgaacacctggcctggctggcgacgtgggcgccggcgcgcatg
agcggttccggcgcctgcgtcttcgccgagttcgccacgctcgacatggccgcgaccaca
ctggcgcaactgcccgcgacgatgcgtggctggctcgcgccgggtctcgaccatcacccc
ctgcgggcgctggccgactga

DBGET integrated database retrieval system