KEGG   Accumulibacter phosphatis: CAP2UW1_2793Help
Entry
CAP2UW1_2793      CDS       T00966                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
app  Accumulibacter phosphatis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3235629..3236702
Genome map
AA seq 357 aa AA seqDB search
MRYRHTTAASAEYLRLAVKRMTQQAAGLHPVSYAIWYEYVAGNNSALNADLDARLKELGR
LDEQTTYALYSRHISEFDAATALRIGDSVDNLVDQVSESAALAGHEASRFGSTLERWSDT
LSEPVSTGGEVASGVADILRGTRNMQNAISTLQTRLEESRRETQQLRQEVARAREEALID
GLTGLSNRKGFDLALTTCLEQATPEMPGPCLLMIDLDNFKRLNDGLGHVFGDRVLSSVGQ
ILRANVKGKDTAARYGGEEFAVILPQTPRGGAIGLAEALRALVAASRIRRVGDEGPLIGN
ITVSIGVADYLAGESPTDFVNRADRALYLAKTQGRNRVILAPRPQPAAGKQADPLPR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagatatcgccataccaccgcagcgagtgccgaatacctgcggctcgccgtcaagagg
atgacgcaacaggcggctggtctgcatccggtgagttacgcgatctggtacgagtatgtc
gcaggcaacaactccgcgctcaatgccgatctcgatgcccgactcaaggaactgggccgg
ctcgacgagcagaccacgtacgcgctctactcgcgccatatctccgaattcgacgcggca
accgccctgcgcatcggcgacagcgtcgacaatctcgtggatcaggtttccgagtcggcc
gcgctggccggtcatgaggcctcgcgcttcggcagtacgctcgagcgctggagcgatacc
ctgagcgagccggtatccaccggtggcgaagtcgccagcggcgttgccgacatcctgcgc
ggcacgcgcaacatgcagaacgcgatcagcacactgcagacgcgcctggaggaaagccgg
cgggagacccagcagctccgccaggaagtcgcacgtgcccgcgaggaagccctgatcgac
gggctgaccgggctcagcaaccgcaagggcttcgatctggctttaacgacctgcctggaa
caggcgacccccgaaatgcccggcccctgcctgctgatgatcgatctcgacaatttcaag
cggctcaacgacggcctcggacatgtcttcggcgaccgggtgctgagcagcgtcggccag
atcctgcgcgccaacgtcaagggcaaggacacggcggcgcgctatgggggcgaggagttc
gccgtgatcctgccgcagacgccacgtggtggcgccatcggcctggccgaggcactgcgc
gcgctggtcgcggccagccgcatcagacgggttggcgacgagggaccgctgatcggcaac
atcacggtgtcgatcggcgttgccgactacctcgccggcgagtcaccaacggacttcgtc
aaccgagccgaccgggctctctacctggccaagacgcagggccgcaaccgggtcatcctt
gccccgcgcccgcagcctgccgccggcaaacaggccgaccccctaccccgatga

DBGET integrated database retrieval system