KEGG   Accumulibacter phosphatis: CAP2UW1_2943Help
Entry
CAP2UW1_2943      CDS       T00966                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
app  Accumulibacter phosphatis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_2943
   00030 Pentose phosphate pathway
    CAP2UW1_2943
   00051 Fructose and mannose metabolism
    CAP2UW1_2943
   00052 Galactose metabolism
    CAP2UW1_2943
   00500 Starch and sucrose metabolism
    CAP2UW1_2943
   00520 Amino sugar and nucleotide sugar metabolism
    CAP2UW1_2943
  Nucleotide metabolism
   00230 Purine metabolism
    CAP2UW1_2943
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CAP2UW1_2943
Enzymes [BR:app01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CAP2UW1_2943
    5.4.2.8  phosphomannomutase
     CAP2UW1_2943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3396799..3398178
Genome map
AA seq 459 aa AA seqDB search
MNAPLPAEIFKAYDIRGIVGKTLTADIVRRIGHGLGSLASERGQRAIAVGRDGRLSGPEL
ATALMEGIRMAGIDTIDVGCVPTPVVYFAAHELGCASCVAVTGSHNPPDYNGLKMVIGGE
TLAGEAIQGIRRRVDADELQHGSGQASSADVRRAYLARITGDVRLARPMKIVIDCGNGVA
GAIAPELFRALGCELVELFCEVDGNFPNHHPDPSKPENLQDVIQALRATDAELGLAFDGD
GDRLGVVTKDGQIIYPDRQLMLFAADVLARCPGQQIIYDVKCTRLLAPWIRAHGGEPLMW
KTGHALVKAKLRETGAPLAGEMSGHVFFKERWYGFDDGLYAGVRLLEILSRAADANAVLE
ALPDSSSTPELNIGMQEGEPFALIEDLRHNAQFTGAREIITIDGLRVEYADGFGLARPSN
TTPVVVLRFEADDSAALERIQADFRRVLNAARPGLALPF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcccctccccgcggaaatcttcaaggcctacgacattcgcggcatcgtcggc
aagacactgacggccgacatcgtccgacgcatcggccatggactcggctcgctggcgagc
gaacgcggccagcgcgcgattgccgtcggccgtgacgggcgcctgtcgggaccggaactg
gcgacggcactgatggaaggcatccgcatggccgggatcgataccatcgacgtcggctgc
gtgccgacgccggtcgtctacttcgccgctcacgaactgggctgcgccagttgcgtcgcc
gtcaccggcagccacaacccacccgattacaacggcctgaagatggtcatcggcggcgag
accctcgccggcgaggcgattcaggggatccgccggcgggtggacgccgacgagctgcag
cacggcagcggccaggcgagcagcgccgatgtccggcgcgcctacctcgcacgcatcacc
ggtgacgtccgtctggcgcgcccgatgaagatcgtcatcgactgcggcaacggcgtcgcc
ggcgccatcgcccccgaactcttccgcgcgctcggctgcgaactcgtcgagcttttctgc
gaggtcgacggcaattttccaaatcaccatcccgacccgtcgaagccggaaaacctgcag
gatgtcatccaggcgctgcgcgcaactgacgccgaactcggactcgctttcgacggcgat
ggcgaccgtctcggcgtcgtcaccaaggacgggcagatcatctacccggaccgccaactg
atgctcttcgctgccgacgtcctcgcccgttgtcccggtcagcagatcatctacgacgtc
aaatgcacgcgcctcctggcaccgtggatacgtgcgcacggcggcgagccgctgatgtgg
aaaaccgggcacgcgctggtcaaggccaagctgcgagaaaccggggcgccgctggcaggc
gaaatgagcggccacgtcttcttcaaggaacgctggtacggcttcgacgacggcctctac
gccggcgttcgcctgctcgagatcctgtcgcgcgccgccgatgcgaatgccgtgctcgag
gctctgcccgacagcagctcgacaccggagttgaacatcggcatgcaggaaggcgagccc
tttgcactgatcgaggatctgcggcataacgcgcagttcacgggagcgcgcgaaatcatc
accatcgacggcttgcgcgtcgagtacgccgacggcttcggtctggcgcggccgtcaaac
acgacgccggtggtggtgctaagattcgaggccgacgacagcgcggcactcgaacgcatc
caggccgatttccggcgcgtcctcaacgcggcgcgacccggtctggcgctgcctttctga

DBGET integrated database retrieval system