KEGG   Accumulibacter phosphatis: CAP2UW1_3181Help
Entry
CAP2UW1_3181      CDS       T00966                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
app  Accumulibacter phosphatis
Brite
Enzymes [BR:app01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CAP2UW1_3181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3658570..3659292
Genome map
AA seq 240 aa AA seqDB search
MFERIRRTRSPQATRVGWSGQSRVLRVGRSLALWFTLLATSLAAPVRAVEDEYAAARTRM
VSEQLRAHWRGITHPGVLQAMATVPRHEFVPLPLRRYAYDDHPLPIGHAQTISQPYVVAF
MTEKLDPKPADRVLEIGTGSGYQAAVLSGLVKEVFSIEIVEPLARRAENDLARLGYRNVR
VRYGDGYQGWPEAAPFDAIIVTCAPDHVPQPLVEQLRDGGRMIIPVGELDDQQLFLLTEV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgagagaattcgccgcacccgcagcccgcaggccacacgcgtcggctggtcgggt
caatcacgcgtgctgcgcgtcggcagatcgctggcactatggtttacgctgctggcaacg
tcgctggcagcgccggtgcgcgctgtcgaagatgagtacgctgcggcgcggacacgcatg
gtaagcgagcaactgcgcgcccattggcgcggcatcacccatccgggagtgctccaggcg
atggctacggtcccacgtcatgagttcgtgccgctgccgctacgccgctacgcgtatgac
gaccacccgctcccgatcggccacgcacaaacgatctcccagccctacgtggttgccttc
atgaccgaaaagctggacccgaaacctgccgaccgcgtcctcgaaatcggtaccggctcg
ggttaccaggcggcggtcctgtcgggcctggtgaaagaagtcttcagcatcgagatcgtt
gaaccgctggctcgacgggctgaaaacgacctcgctcgcctcggctaccgcaacgtcagg
gtgcgctacggcgacggctatcagggttggccggaagccgcacctttcgacgcgatcatc
gtcacctgcgcacccgatcatgtaccgcagccactcgtcgagcaactcagggacggcggg
cgaatgatcatcccggtcggcgaactcgatgatcagcagctgttcctgctgactgaagtt
tag

DBGET integrated database retrieval system