KEGG   Accumulibacter phosphatis: CAP2UW1_3419Help
Entry
CAP2UW1_3419      CDS       T00966                                 

Definition
Nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
app  Accumulibacter phosphatis
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    CAP2UW1_3419
Enzymes [BR:app01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     CAP2UW1_3419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3928025..3930322)
Genome map
AA seq 765 aa AA seqDB search
MKFRTKQVAPLLLAAGFGCAAVGIAYAAESLQDVMKRRNLSQQDLLAASKTYVPTGKRDE
FVAFSSGGQSGQVIVYGIPSMRILKYIGVFTPEPWQGYGFDEESKAVLRQGSIDGKEINW
GDTHHPAISETQGKYDGQFLFINDKANPRLAVIDLRDFETKQIVVNPIFKSEHGGAFVTP
NTEYVIEAAQYATPLENKKFYPLEEFNEKYRGGVTYWKFDRKAGRIDPKQSFSLELPPYS
QDLSDAGKGPSDGWSFTNSFCSERYVGGIEKGRPPYEAGCSAKDTDYLHVINWKKAAELV
AAGKAKKINGHDVLMMDTAIKEGILFLVPEPKSPHGVDVTPDGKFITVAGKLDTHVSVYS
FEKIQAAIKAGKFESKDPYGIPVINMKDALHTQVQLGLGPLHTQYDAKPCVAYTSLYVDS
QVVKWNFCEGKVLDKISVHYNIGHLMTMEGDSVDPKGRYLVALNKLAIDRFVPVGPLHPQ
NHQLIDISDDKMQLLYDMPLPLGEPHYVVAIEAGKLKPGVRYKVGTNSRTDQPNPGAVRA
GEEKTVKKGNKIEVFGTLIRSHITPETIEAEVGDEVTIHLTNLERAQDETHGFTVSTYNV
HASVEPGKTVTVKFKADKEGVYPYYCTEFCSALHLEMQGYLLVKPKGWKPTKTAGTAGAN
YTEADYKTQLKKVADTQAVIDSVVGYITSVNYKDFPDVVNMMDDAVDQLGKIKDAKAKAD
EAAGKKDWNNAALWTEQIWQYQVKAADLGLRAKTYLEQNGAKKVK
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgaaattccgcaccaagcaggtcgcgccattgctgctcgcagcagggttcggctgcgcc
gccgtcggcatcgcgtatgccgccgaatcgctgcaggacgtcatgaagcgccgcaacctt
tcacagcaggatctgctggccgcttcgaagacctatgtgccgaccggcaagcgcgacgag
ttcgtcgccttctcgtcgggcggtcagtctgggcaggtgatcgtctatggcattccctcg
atgcgcatcctcaagtacatcggcgtgttcacgcccgagccctggcagggttacggcttc
gacgaggagtcgaaggcggttctccggcaaggcagcatcgacggcaaggaaatcaactgg
ggcgatacgcaccacccggcgatatccgagacgcagggcaagtacgacggccagttcctg
ttcatcaacgacaaggccaacccgcgtctggcggtgatcgacctgcgcgacttcgagacc
aagcagatcgtcgtcaacccgatcttcaagtccgaacacggcggcgccttcgtcacgccg
aacaccgagtacgtgatcgaggccgcgcagtatgcgacgccgctcgagaacaagaagttc
tacccgctcgaggagttcaacgagaagtaccgcggcggcgtcacctactggaagttcgac
cgcaaggcaggacgcatcgatcccaagcagtcgttctcgctcgagttgccgccgtacagc
caggatctctcggatgccggcaagggcccgtcggacggttggtcgttcaccaattccttc
tgcagtgagcgctacgtcggcggcatcgaaaagggacggcctccttatgaagcgggctgc
tcggccaaggataccgactatctgcacgtgatcaactggaaaaaggcagccgaactggtg
gctgccggcaaggcgaagaagatcaatggccacgacgtgctgatgatggacaccgcgatc
aaggaaggcatcctcttcctggtgccggaacccaagtcgccgcacggcgtcgatgtgact
ccggacggcaagttcatcaccgtcgccggcaagctcgacacgcacgtctcggtgtattcc
ttcgagaagatccaggcggcgatcaaggccggcaagttcgaatcgaaggatccctacggc
atcccggtgatcaatatgaaggacgcgctgcatacccaggtgcagctcggcctcgggccg
ctgcatacccagtacgatgccaagccctgcgtcgcctatacctcgctgtacgtcgactcg
caggtcgtcaaatggaacttctgcgaaggcaaggtgctcgacaagatcagcgtccattac
aacatcggtcacctgatgacgatggaaggtgattcggtcgatcccaagggccgctatctg
gttgccctcaacaagctggcgatcgaccgtttcgtgccggtcgggccgctgcatccgcag
aaccaccagttgatcgacatcagcgacgacaagatgcaactcctctacgacatgcccttg
ccgctcggcgagccgcactacgtggtcgccatcgaagccggcaagctcaagccaggcgtt
cgctacaaggtcggcaccaacagccggaccgaccagccgaacccgggtgcggtacgtgcc
ggtgaagagaagacggtcaagaagggcaacaagatcgaagtcttcgggacgctgatccgc
tcgcacatcacgcccgaaacgatcgaagccgaagtcggcgacgaagtcaccatccacctc
accaacctcgagagggcacaggacgagacgcacggcttcacggtttcgacctacaacgtg
cacgcctcggtcgagcccggcaagacggtcacggtcaagttcaaggccgacaaggagggc
gtctacccgtactactgcacggagttctgctcggcgctgcacctcgagatgcagggctac
ctgctggtcaagccgaagggctggaaaccgaccaagaccgccggtacggcgggcgccaac
tacaccgaggccgactacaagacgcagctgaagaaggtggccgatacgcaggcggtgatc
gactcggtcgtcggctacatcacgagtgtcaattacaaggacttcccggacgtggtcaac
atgatggacgacgccgtcgatcagctgggcaagatcaaggacgccaaggccaaggctgac
gaagcagccggcaagaaggactggaacaacgccgcgctgtggaccgagcagatctggcag
taccaggtcaaggctgccgacctcggcctgcgcgccaagacctacctcgagcagaacggc
gccaagaaggtcaagtaa

DBGET integrated database retrieval system