KEGG   Accumulibacter phosphatis: CAP2UW1_3595Help
Entry
CAP2UW1_3595      CDS       T00966                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
app  Accumulibacter phosphatis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:app00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:app00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4104588..4105547
Genome map
AA seq 319 aa AA seqDB search
MRNPQLNANGELTHLLSIQGLPRDVLIHILDTASSFLKVSDRNVKKVPLLRGKSVFNVFF
ENSTRTRTTFEIAAKRLSADVINLDVTRSSTAKGETLLDTVDNLVAMHADMFVVRHAASG
APHLIADHLRRLGRNDVHVVNAGDGRHAHPTQGLLDMYTIRHYKKDFDQLVVAVVGDILH
SRVARSDLHALTTLGAAEVRAVGPQTLLPTAMETMGVRVCHDLRAGLRDCDVIIMLRLQN
ERMNGALLPSAREYFACYGLTPAMLALAKPDAIVMHPGPMNRGVEIDSDVADGPQAVILP
QVTFGIAVRMAVMGILAGN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatccccaactgaacgccaatggcgaattgacccacctgctgtcgatccagggc
ttgccccgtgatgtgctgatccacattctcgatacggcgtcaagctttctcaaggtttcc
gaccgtaacgtcaagaaggtgcccctgttgcgcggcaagagtgtgttcaatgtgtttttc
gagaactcgacccgtacccgcacgaccttcgagatcgccgccaagcggctgtcggcggac
gtcatcaacctcgacgtgacgcgctcctcgaccgccaagggcgagaccctgctcgacacg
gtagacaacctggtggccatgcacgccgacatgttcgtcgtcaggcacgcggccagcgga
gcgccgcacctgatcgccgaccacctgcgccgactcgggcggaacgacgtgcatgtcgtc
aatgccggcgacggacgccacgcgcacccgacccagggcctgctggatatgtacaccatc
cgccactacaagaaggatttcgaccagctcgtggtagcggtagtcggcgacattctccac
tcacgggtcgcccgctcggatctgcacgccctgaccacgctgggtgccgccgaggtgcgt
gcggtggggccgcagaccctgttgccgacggccatggaaaccatgggcgttcgcgtgtgc
cacgatctgcgtgccgggctgcgcgactgtgatgtaatcatcatgctgcggctgcagaac
gagcgcatgaatggcgccttgctgccgtccgcccgcgaatacttcgcttgttacgggctg
acgccggcgatgctggcgctggccaagccggacgccatcgtgatgcaccccggaccgatg
aatcgcggcgtcgagatcgactccgacgtcgccgacggaccgcaggcggtgatcctgccg
caggtcaccttcgggatcgccgtcagaatggcggtcatgggaattctcgcggggaactga

DBGET integrated database retrieval system