KEGG   Accumulibacter phosphatis: CAP2UW1_3616Help
Entry
CAP2UW1_3616      CDS       T00966                                 

Definition
Malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
app  Accumulibacter phosphatis
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CAP2UW1_3616
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CAP2UW1_3616
Enzymes [BR:app01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     CAP2UW1_3616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4124700..4126085
Genome map
AA seq 461 aa AA seqDB search
MPAGIVVRGLRKVRTLLAEGPGLRGLDGKQLVRIRELLHECASGVGGEISARQRAGRLAE
AYLRLDDEGRATFLRVIATEFGPDPQLVAKAHADYQAAIDSNDRWTAESALRNAMRSSRL
RVLTQFTALPQGVKFLVDLRADLLRLIGQDPALRSLDRELETRLSAWFDVGFLELQRITW
NSPATLLEKLIEYEAVHEIRSWSDLKNRLDSDRRCYAFFHPRMPMEPLIFVEVALTDKLA
DNVQTLLDEHAPVFDAPRANTAIFYSISNTQVGLRGVSFGNFLLKRVVDDLKRDYPRLIN
FATLSPLPSFRRWAEKNPEAWQKAFSEADLERIRRHQAAGTTKIDNASDLATLLADDGWA
DDDRLARALQHGLMRLAARYLLTPDKGGRPYDPVARFHLGNGARIERLNYLADTSARGRR
QSYGLMVNYLYDPDTIEANVEAFSRGGEMAANPAIRRSARD
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaggaattgttgtccgggggctgcgcaaggtgcgcacactgctcgccgaaggt
cccggcctccgcggtctcgatggcaagcaactagtgcgaatccgcgagttgctgcatgaa
tgcgccagcggcgtcggcggcgaaatctcggcgaggcagcgcgccgggcggctcgcggaa
gcctatctgcgtcttgatgacgaaggtcgcgcgacgttcctgcgcgtcattgccaccgaa
ttcggccccgatccgcagctggtcgccaaggcacatgccgactaccaggcagccatcgac
agcaacgaccggtggactgccgagtcggcgctacgcaatgccatgcgttcgtctcgcctg
cgcgtcctgacgcaattcaccgccctgccgcaaggcgtcaagttcctggtcgatctccgc
gccgatctgctccgtctgattggccaggatcccgccctgcgctcgctcgaccgagaactc
gaaacccgtctgagcgcatggttcgacgtgggtttcctcgagttgcaacggatcacctgg
aactcgccggcaacgctcctcgaaaaactgatcgagtacgaagcggtgcacgagatccgt
tcctggagcgacctcaagaaccgccttgattccgatcgccgctgctacgcgttcttccac
ccacgcatgccgatggaaccgttgatcttcgtcgaggtggcgctgaccgacaagctcgcc
gacaacgtccagaccctgctcgatgagcatgcgccggtcttcgatgcgccacgcgccaat
acggcgatcttttattcgatctcgaacacgcaggtcggtctgcgcggcgtgtcgttcggt
aacttcctgctcaagcgcgtggtcgacgatctgaagcgcgactacccgcgtctcatcaac
tttgcgaccctatcccccctgccctccttccgtcgctgggccgagaagaatccggaagcc
tggcagaaggctttcagcgaagccgatctggagcggatcaggcgacaccaggcggccggg
acgacgaagatcgacaacgcaagcgatctggcgacgctgctcgccgacgatggttgggcc
gatgatgaccgcttggcacgcgccctgcagcatggcctgatgcggcttgccgcgcgctac
ctgctgactcccgacaaaggcggacgtccttacgacccggttgcccgtttccatctgggc
aacggggcgcgcatcgagcgcctcaactatctggcggacacctcggcgcgcggccggcga
cagtcgtatggactgatggtgaattatttgtacgaccctgatactatcgaagcgaacgtc
gaggctttttcacgcggtggtgagatggctgcgaaccccgcaatacgccgttctgcccgc
gactga

DBGET integrated database retrieval system