KEGG   Accumulibacter phosphatis: CAP2UW1_3678Help
Entry
CAP2UW1_3678      CDS       T00966                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
app  Accumulibacter phosphatis
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:app00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:app02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4204966..4205334)
Genome map
AA seq 122 aa AA seqDB search
MIVAERLLPAVLGLALAGAAAAADPGRGAGLYEARCGACHSLDAHRVGPLHRGVVGRRAG
SAPGYDYSPALAAAAFTWDAALLDAWLKDPEALVPGQRMGYSVADASDRGDLVAFLLSVS
RR
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttgccgagcgactgctgccggcggttctggggttggccctggcgggtgccgcc
gcggccgccgaccccgggcgcggtgccggtctctacgaggcgcgctgcggtgcctgccat
agcctcgatgcccatcgcgtcgggccgctgcaccggggcgtcgtcggtcgccgtgccgga
tcggctcccggatacgactactcaccggcgctggccgctgccgcctttacctgggacgcg
gccctgctcgatgcctggctgaaggatccggaagcactggttcccggccagcgcatgggc
tattcggttgccgatgccagcgaccggggcgacctggtggccttcctgctgtcggtatcg
cggcgctga

DBGET integrated database retrieval system