KEGG   Accumulibacter phosphatis: CAP2UW1_3755Help
Entry
CAP2UW1_3755      CDS       T00966                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
app  Accumulibacter phosphatis
Pathway
app00010  Glycolysis / Gluconeogenesis
app00620  Pyruvate metabolism
app00640  Propanoate metabolism
app00680  Methane metabolism
app01100  Metabolic pathways
app01110  Biosynthesis of secondary metabolites
app01120  Microbial metabolism in diverse environments
app01130  Biosynthesis of antibiotics
app01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_3755
   00620 Pyruvate metabolism
    CAP2UW1_3755
   00640 Propanoate metabolism
    CAP2UW1_3755
  Energy metabolism
   00680 Methane metabolism
    CAP2UW1_3755
Enzymes [BR:app01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CAP2UW1_3755
Lipid biosynthesis proteins [BR:app01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CAP2UW1_3755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACV37005
JGI: CAP2UW13755
UniProt: C7RL56
Position
complement(4298327..4300291)
Genome map
AA seq 654 aa AA seqDB search
MSLNEAVTFIEPSAEFVKQATISGMDAYKALCAEAAKDYTGYWARLAREHVSWKQPFTQV
LDESNAPFFKWFADGTLNASYNCLDRNIEAGLGDKVAIVFEADDGAVTRVTYKELLSRVS
QFANGLRARGIKKGDRVVIYMSMGVEGIVAMQACARIGAIHSVVFGGFSAQSVRDRINDA
GAVAVITADEQCRGGKKIPLKPAVDEGIALGGCESIKDVIVLQRTGGACNMVAGRDIWWH
DVIAGQSDVCEPEWVEAEHPLFLLYTSGSTGKPKGVQHSTGGYLLHAIVTMKWTFDLKPN
DLFWCTADIGWVTGHTYITYGPLACGGTEIVFEGIPTYPDAGRFWKMIQDHKVNIFYTAP
TAIRSLVKAADTNQAVAPTQYDLSSLRLLGTVGEPINPAAWQWYYDSVGGGRCPIVDTFW
QTETGGHMITPLPGVTPLVPGSCTLPFPGIQAAVVDETGTELDWGKGGLLVVKRPWPAMI
RNIWGDPERFKKSYYPDDFNGKLYLAGDGSIRDVNTGYFTITGRIDDVLNVSGHRMGTME
IESALVSHPMVAEAAVVGRPDDLTGEAICAFVVLKGPRPTGEAAKKMIKELQDHVGREIG
PIAKPKDLRFGENLPKTRSGKIMRRLLRSLAKGETVAQDVSTLENPAILEQLRG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgaacgaggccgtaactttcattgagccatccgccgagtttgtcaaacaggca
acgatttccggcatggatgcctacaaggccttgtgtgccgaggcagccaaggactacacg
ggctactgggcacggctggcgcgtgaacacgtgtcgtggaagcagccgttcacccaggtg
cttgacgagtccaatgccccgtttttcaagtggtttgccgacggtactctgaacgcttcc
tacaactgcctcgaccgcaacatcgaggcgggtctcggcgacaaggtggcgatcgtcttc
gaagccgatgacggcgccgtcaccagggtcacctacaaggaattgctgtcccgcgtcagc
cagttcgccaacggcctgcgtgcgcgcggtatcaagaaaggggaccgggtcgtcatctac
atgtcgatgggtgtcgagggaattgtcgcgatgcaggcctgtgcgcgcatcggcgccatt
cactcggtggtcttcggtggtttctccgcgcagtcggtgcgcgaccggatcaacgacgcc
ggtgccgtcgcggtgatcaccgccgacgagcagtgccggggtggcaagaagatcccgctc
aagccggccgtcgacgaaggtatcgccctcggtggttgcgagtcgatcaaggatgtcatc
gtcctccagcgcaccggcggcgcctgcaacatggtcgccggccgtgacatctggtggcac
gacgtgatcgccggccagtccgatgtctgcgagccggaatgggtggaagccgagcacccg
ctttttctgctctacacctcgggttcgacgggcaagccgaagggcgtgcagcactcgacc
ggtggctacctgctgcatgcgatcgtgacgatgaagtggaccttcgacctgaagcccaac
gatctcttctggtgcacggcggacatcggctgggtgaccggtcacacctacatcacctat
gggccactcgcctgcggcggtaccgagatcgttttcgaaggcatcccgacctatcccgat
gccggtcgtttctggaagatgatccaggaccacaaggtcaatatcttttacacggcgccg
accgcgatccgctcgctggtcaaggcggccgataccaatcaggcggttgcgcccacgcag
tacgacctgtcgtctctgcgcctgctcgggacggttggcgagccgatcaatccggccgcc
tggcagtggtactacgatagcgtcggcggcggccgttgcccaatcgtcgataccttctgg
cagaccgaaaccggcggccacatgattaccccactgccgggcgtcacaccgctggtgccg
ggctcctgcaccctgcctttccccggtatccaggctgccgtcgtcgatgaaaccggcacc
gagctcgactggggcaagggtggcctgctcgttgtcaagaggccgtggccggcgatgatt
cgcaacatctggggcgatcccgagcggttcaagaagtcctactatcctgacgacttcaat
ggcaagctgtaccttgccggcgacggttcgatacgcgatgtcaatacgggctatttcacg
attaccgggcgtatcgacgatgtgctcaacgtctccgggcatcggatgggaacgatggaa
atcgagtccgcactggtttcacacccgatggtcgcggaagcggcggtggttggccggccg
gatgatctgaccggcgaggcgatctgtgcctttgtcgtgctgaaagggccgcggccaacc
ggcgaggcagcgaagaagatgatcaaggaattgcaggatcatgttggccgtgagatcggg
ccgattgccaaacccaaggatctgcgcttcggtgagaacctgccgaagacacgatccggc
aaaatcatgcgccgtctgctgcgttctctggccaagggggaaaccgtcgcgcaggatgtg
tcgacgctcgagaatccggccattctcgaacaactgcgcggctga

DBGET integrated database retrieval system