KEGG   Accumulibacter phosphatis: CAP2UW1_4033Help
Entry
CAP2UW1_4033      CDS       T00966                                 

Definition
Histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
app  Accumulibacter phosphatis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CAP2UW1_4033
  Amino acid metabolism
   00340 Histidine metabolism
    CAP2UW1_4033
Enzymes [BR:app01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CAP2UW1_4033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4600791..4602104
Genome map
AA seq 437 aa AA seqDB search
MINIKRLTTSDADFGARLDALLAFESAQDASVEQTVAAILADVKTRGDAALIEYTRRFDG
LRATSMAELELSQNELQAALAGLPADQRQALEAAAERVRSYHERQTLESWQYVDDGADAC
GTLLGQKVTPLDRVGLYVPGGKASYPSSVLMNAIPARVAGVAELIMVVPTPAGEHNPLVL
AAAALAGVDRVFTIGGAQAVAALAYGTQTVPQVDKIVGPGNAYVAAAKRRVFGVVGIDMV
AGPSEILVICDGHTEPDWVAMDLFSQAEHDELAQSILICPDAVYIERVAASLEKLLPTMP
RQQVIRAALENRGALIEVRDLDEACRIANRIAPEHLELSLADADAWVAKIRHAGAIFIGR
YTSESLGDYCAGPNHVLPTSGSARFSSPLGVYDFQKRTSLIRVSPAGSRILGRIAATLAH
GEGLPAHARSAEYRVDG
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacatcaagcgcctgaccacgagcgacgccgatttcggcgcgcgcctcgatgcc
ctgctggccttcgagtctgcgcaggacgcatccgtcgaacagacggtcgccgccatcctg
gcggacgtgaagacacgcggcgacgccgcactcatcgagtacaccaggcgtttcgacggc
ctgcgtgcgacttcgatggccgaactggaactctcgcagaacgaactgcaggcggcactc
gccggtctgccggcagaccagcggcaggcactcgaagccgccgccgaacgcgtgcgcagc
taccacgaacggcaaacgctggagagctggcaatatgtggatgacggtgcagacgcgtgt
gggacgctgcttggccagaaagtgacgccgctcgaccgcgtcggcctctatgtgcccggt
ggcaaggcgtcttacccgtcgtcggtgctgatgaacgcgattcctgcgcgcgtcgccggc
gtcgccgaactgatcatggtcgtgccgacaccggccggcgagcacaacccgctggtcctc
gccgctgccgcgctcgccggcgtcgatcgcgtgtttaccatcggcggagcacaggcggtc
gcggcgctggcctacggcacgcagacggttccccaggtggacaagattgttggtccgggc
aacgcctacgttgccgccgccaagcgccgcgtcttcggcgtcgtcggcatcgacatggtc
gccggcccgtcggagatcctcgtcatctgcgacggccataccgagcccgactgggtggcc
atggatctgttctcgcaggccgagcacgacgaactcgcgcagtctatcctgatctgtccg
gacgctgtctatatcgagcgcgtcgccgcatccctggagaaactgttgccgacgatgccg
cgccagcaggtgattcgtgccgcgctggagaaccgcggcgcgctgatcgaggtgcgcgac
ctcgacgaagcgtgccgcatcgccaaccgcatcgcccccgaacacctcgagctgtcgctg
gccgatgccgacgcctgggtagcgaaaatccgccacgctggcgcgatcttcatcggccgc
tatacctcggagtcgctcggcgactactgcgccgggcccaaccacgtcctgccgacctct
ggcagcgcccgcttctcgtcaccgctcggggtctatgacttccagaaacggaccagcctg
atccgcgtctcgccggcgggttcccggatcctcggccgcatcgcggcgacgctggcgcat
ggcgagggcctgccggcacacgcccgctcggccgagtatcgcgtcgacggctga

DBGET integrated database retrieval system