KEGG   Accumulibacter phosphatis: CAP2UW1_4128Help
Entry
CAP2UW1_4128      CDS       T00966                                 

Definition
DNA polymerase III subunit chi HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
app  Accumulibacter phosphatis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CAP2UW1_4128
   00240 Pyrimidine metabolism
    CAP2UW1_4128
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CAP2UW1_4128
   03430 Mismatch repair
    CAP2UW1_4128
   03440 Homologous recombination
    CAP2UW1_4128
Enzymes [BR:app01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CAP2UW1_4128
DNA replication proteins [BR:app03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CAP2UW1_4128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4703344..4703769
Genome map
AA seq 141 aa AA seqDB search
MTQVFFYHGASDRIVATATLLGKAFAQKKAALVYAPDAEVAAALDRHLWMHPPTGFLPHV
RSDSPLAGETPVLIASQLDVVPQDERLFNLAAEVPPGFSRFASLIEVVGHQDEERAAGRQ
RARFYKDRGYDITYVDLSGKG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
ttgacccaggttttcttctaccatggcgccagcgaccgcatcgtggcgacggccaccttg
ctcggcaaggcgttcgcccagaagaaagccgcgctggtctacgcaccggatgccgaggtg
gcggccgcgctggaccgccacctttggatgcacccgccaacaggtttcctcccgcacgta
cgcagcgattcgccgctggccggcgagacgccggtgctgatcgccagccagctggacgtc
gtgccccaggacgagcgcctcttcaatctcgcagccgaggtgccgccggggttctcccgc
tttgccagcctgattgaagtcgtcggccatcaggacgaggagcgcgccgccggccgccag
cgcgccaggttctacaaggatcgtggctacgacatcacctatgtcgatctgtcagggaaa
ggctga

DBGET integrated database retrieval system