KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_00250Help
Entry
APA22_00250       CDS       T01815                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:apq01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apq00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:apq00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:apq00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:apq00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:apq00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(23076..24104)
Genome map
AA seq 342 aa AA seqDB search
MSGKMKAAVVHEFGKPLTIEELDIPPIKPTQILVKMIACGVCHTDLHAASGDWPKKPHLP
FIPGHEGVGTVVQVGSEVDWVKEGDVVGVPWLYSACGHCEHCLAGWETLCAKQEETGYSV
NGCFAEYVVADPNYIAHLPKGVDPVKVAPVLCAGLTVYKGLKMTDTRAGNWVAISGVGGL
GQMAVQYAVAMGLNVVAVDIDDEKLATAKKLGATYTVNARNTDPAAFMQEKVGGVHGGLI
TAVSTKAFSQAMGYVRAGGTLVLNGLPPGDFPISIFDMVMNAITIRGSIVGTRLDMIEAL
SFFAEGKVTSVTTTDRIDNINAIFDALKNGRVEGRVVLDFRN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaaaaatgaaagccgctgtggttcatgaatttggcaaaccactgaccattgaa
gaactggacattccccccattaaacctacccagattttggttaaaatgattgcctgcggc
gtgtgccatacagatttgcatgctgccagcggggattggcccaaaaaaccacatctgccg
tttatccccggccacgaaggcgttggcacggttgtgcaggttggcagcgaagtagattgg
gtaaaggaaggcgatgttgttggcgtgccttggctctattctgcctgtggccattgcgag
cattgtctggctgggtgggaaaccctttgcgcgaagcaggaagaaactggctattccgta
aacggctgctttgccgaatacgtggtagcagaccctaactacattgctcatcttcccaaa
ggcgtagaccccgtaaaagttgctcccgtactgtgcgcaggcctgaccgtttataaaggc
ctgaaaatgacagacacgcgggcagggaactgggttgccatttccggcgttggggggtta
ggccagatggctgtgcagtacgccgtagcaatggggctgaatgttgtggcggtagatatt
gatgatgaaaaactggcaaccgccaaaaagcttggtgcaacgtacactgttaacgccaga
aatacagatccggcagcatttatgcaggaaaaagttggtggcgtacacggtggattgatc
accgctgtttccaccaaagcattttctcaggctatgggttatgtgcgggcagggggcact
ttggtgctaaatgggctgccgccgggtgatttcccaatttctatctttgacatggtcatg
aatgccattaccattcgcggctccatagtaggcacacggctggacatgattgaagctctt
tccttctttgcggaaggaaaggtaacatctgtcaccacaacggatcggattgataacatc
aacgcaatttttgatgcgctcaagaacggtcgggtggaaggccgcgtggttctggacttc
cgcaactga

DBGET integrated database retrieval system