KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_03620Help
Entry
APA22_03620       CDS       T01815                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
apq00010  Glycolysis / Gluconeogenesis
apq00620  Pyruvate metabolism
apq00640  Propanoate metabolism
apq00680  Methane metabolism
apq01100  Metabolic pathways
apq01110  Biosynthesis of secondary metabolites
apq01120  Microbial metabolism in diverse environments
apq01130  Biosynthesis of antibiotics
apq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA22_03620
   00620 Pyruvate metabolism
    APA22_03620
   00640 Propanoate metabolism
    APA22_03620
  Energy metabolism
   00680 Methane metabolism
    APA22_03620
Enzymes [BR:apq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     APA22_03620
Lipid biosynthesis proteins [BR:apq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   APA22_03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAI07659
Position
374509..376497
Genome map
AA seq 662 aa AA seqDB search
MSENITILPTQYADYPALMPPAELAAMQRYARRDPDGFWLQQARRVHWHRKPRRGFTGSF
TGDVSISWFEDGLINASVCCIDKHLTDKADQIALISHREGRAEAEKITYAMLHERVCRLS
NALVHLGVEEGHRVAICLPMISEAVVAMLACARIGAVHVVLFGGFSAEGIAERIIDSGAV
AVITASESMRGNKIVPFKAIMDEALCKAGAESGVRAVLVVRTSDAPVPMLPGRDYDFHDF
VDSFEADFVPVVMRAEAPLFMLYTSGSTGKPKAVVHATGGYMVWAAYTMDMVYHHQPGDV
LWCTADVAWITGHTSVVYGPLANGGTTMISDSLPSYPAPGRWLDLIDEHKVTMLFTAPTA
VRAMMADGDDVVNARNLESLRLLGVAGEPISPDAWLWYHDVVGKKRCPVVDTWWQTETAG
IVLGPVPGVQPLKPGSASTPLPGLEMVIADTQGRPVQGPAEGSLCIARSWPGQARTIWKD
HARFCQTYFGMVPGHYFTGDGARRDADGYYWITGRMDDVINIAGHRLGTAEVEDALAADH
RIVESAAVGIPHPVKGQALAVFVIQRQNVATELTEKGISRLISGMLGRYATPEAVYLVPD
LPRTRSGKIVRRLLRKIASGEMDNLGDLSSLNDPSIVRMLCDRVWSHMAFDEESAPRTQA
RA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaacatcactatcctgcctacacagtatgcagattacccggctctgatgcca
cctgcggaactggccgccatgcagcgctatgcacgccgagacccggatggtttttggctg
caacaggcccggcgtgtgcactggcaccgcaagcctaggcgaggctttacgggcagcttt
acgggtgatgtgtccataagctggtttgaagatggccttatcaacgcatccgtatgctgt
attgataagcatctgacagacaaggctgatcagattgcccttatcagccaccgtgaaggc
cgggccgaggcagaaaaaattacatatgccatgctgcatgaacgggtttgccgcctgtct
aacgcgctggtgcatttgggggtggaggaagggcaccgcgttgccatttgcctgcccatg
atttcagaagccgtggtggccatgctggcctgtgcgcgtattggcgcggtgcatgtggtg
ctgtttggtggtttttcggcagaaggtattgcagaacgtattatagatagcggcgcagtt
gcggtaattaccgccagcgaaagcatgcgcggcaacaagatcgtgccctttaaagcgatt
atggatgaagccctgtgcaaggcaggtgcagaaagtggcgtgcgggctgttctagttgtg
cgcacgtctgatgcacctgttcccatgctgcctggtagggattacgattttcatgatttt
gtagattcgtttgaggcagattttgtgcccgttgtcatgcgggcagaagcaccattattt
atgctctacacatctggcagcacaggcaagcccaaagcagttgtgcatgccactggtggc
tatatggtgtgggcagcttacactatggacatggtgtaccatcatcaacctggtgatgtg
ctgtggtgcacggcagatgtggcatggataaccgggcatacatccgttgtgtatggcccg
ctggccaatggcggaaccaccatgatttccgatagcctgccttcataccccgctccgggc
agatggttggatctgatagatgagcataaggtgaccatgctgtttaccgcccccacagcc
gtgcgcgccatgatggccgatggtgatgatgtggtgaacgcccgcaatctggagtctctg
cgtttgctgggtgtggcgggggagcccataagcccggatgcgtggctatggtatcacgat
gttgtgggtaaaaagcgttgccccgtggtggatacatggtggcagacagaaaccgccggc
attgtgctggggccagtgccgggtgtgcaaccgcttaaacccggctctgccagcacgccg
ctgccggggttggaaatggtcatagccgatacgcagggcaggccggtgcaggggcctgca
gaaggtagcctgtgcattgcgcgttcatggccggggcaggcccgcacaatctggaaagat
catgctcgcttctgccagacatattttggtatggttccggggcattatttcacgggtgat
ggcgcacggcgagatgccgatggctattactggattacggggcgcatggacgatgttatc
aatattgcagggcaccgtttgggtacagcagaagtggaagatgcgttggcagcagatcat
cgtattgtggaatctgctgcagtgggcatcccgcacccggtaaaggggcaggcgctggcg
gtatttgttatccagcgccagaacgtggctacggaactgacagaaaaaggcataagccgc
cttatctccggtatgttggggcgttatgccacgccagaggccgtttatctggtgccagat
ctgcctcgcacgcgctctggcaagattgtacgccgcctgctgcgcaaaattgccagtggg
gaaatggataatctgggagatctttcatcgctgaatgatccttccatcgtgcgtatgctg
tgtgacagagtatggagccacatggcttttgatgaggaatctgcacctcgcacacaggca
agggcctga

DBGET integrated database retrieval system