KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_05960Help
Entry
APA22_05960       CDS       T01815                                 

Definition
esterase/lipase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:apq01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apq00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:apq00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:apq00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
614304..615470
Genome map
AA seq 388 aa AA seqDB search
MPNTITALTMPKFGLAMTEGKLASWTVPVDQSVQQGDELADIETTKITSSYESPAAGVLR
KQVAEAGETLPVGALIGVLADAETPDVDIEAFIKNFHAENPQDAAATEDANAGEPKPVTV
GEHTLNVRDVGTHTGTPIVLVHGFGGDISNWLLTQDALAADRRVIAFDLPGHGASSKNVG
TGTLAFLAGVVSELLKTLKIEKAHVVGHSLGGGIALTLLRDHPDQVASLNLLAPAGLGKD
VNSDFISAFVDSESSRDMKAVLQMLVHNKALVGRKMVDAVLRARRLDGARDALHVIAKAC
FPNGHQADDLRPVLAGAETPTQIFWGKEDEILSVSNASGLPDVIPVTVYEETGHLPQLER
ATDVNKAIAVFVKDPEAALSMARMDATA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacaccattacagccctcaccatgcccaagttcggtttggccatgacagaaggc
aaactggcatcatggacggtgccagttgaccagagcgtgcagcagggtgatgaactggcg
gatattgaaaccaccaaaattaccagcagttatgaaagccccgccgcaggtgtgttgcgc
aaacaggtggcagaggcgggggaaaccctgcccgtgggcgcactgattggcgtgctggct
gatgccgaaacgcccgatgtggatattgaagcctttatcaagaactttcatgccgaaaac
ccgcaggatgccgccgccacggaggatgccaacgccggagaacccaagccggtaacggtg
ggggaacacacgctgaatgtgcgtgatgtgggcacacatacgggcacgcccattgtgctg
gtgcacggttttggcggagatattagcaactggctgctcacgcaggatgctctggccgca
gacaggcgcgtgattgcgtttgacctgccggggcatggggcttcttccaaaaacgtgggc
acaggcacgctggcgtttttggccggcgtggtgagcgaattgctgaaaaccctgaaaata
gaaaaagcccatgtggtgggccattctctgggtggcggcattgcgctgaccctgctgcga
gaccaccccgatcaggttgccagcctgaaccttctggcccccgccgggttgggcaaggat
gtgaattcagatttcatcagcgcgtttgtggatagtgaaagcagccgcgatatgaaagct
gttttgcaaatgctggtgcataacaaagcccttgtgggccggaagatggtggatgccgtg
ctgcgtgcccgccggttggatggcgcgcgtgatgccctgcacgttattgccaaggcgtgc
ttccccaacgggcatcaggcggatgatttgcgcccggtcttggccggggcggaaacaccc
acccagattttctggggtaaggaagatgaaattctttctgtttccaacgcatccggcctg
ccagatgtcattcccgtaacggtgtatgaagaaacaggccatctgccgcagcttgaacgc
gcaacagatgttaacaaagccattgccgtgtttgtaaaagaccccgaagccgcgctgagc
atggcccggatggacgctacagcctaa

DBGET integrated database retrieval system