KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_11170Help
Entry
APA22_11170       CDS       T01815                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    APA22_11170
   00052 Galactose metabolism
    APA22_11170
   00500 Starch and sucrose metabolism
    APA22_11170
   00520 Amino sugar and nucleotide sugar metabolism
    APA22_11170
Enzymes [BR:apq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     APA22_11170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1178324..1179214
Genome map
AA seq 296 aa AA seqDB search
MSKPKPLRKAVLPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAIDEAREAGIEEFCLIT
GRGKDSLIDYFDIAYELEDTLRERNKIDCLKALEPSSIEAGSLIAVRQQEPLGLGHAIWC
ARSFIGDDPFAILLPDDIVQAAPGKGCLKQLADAYNETGGSVVAVTEVPREQTNRYGILD
TGKDDGRLVEVKGLVEKPKPEDAPSNLSIIGRYVLTPEVMPYLSKLEKGAGGEVQLTDAM
AKTIGQVPFHGLRYEGTRYDCGNKLGFLEAQVAFALERPDLADGVKEFLKKYTDKI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaacccaagcctttacgtaaagcagtcctgcctgttgcgggattgggaacgcgc
tttctgcccgcaaccaaggccatgccaaaggaaatgctgcctgttgttgacaggccgctg
atccagtatgcgattgatgaagcgcgtgaagccgggattgaagagttctgcctgattaca
ggccgcggtaaggactctcttattgattactttgatattgcttacgagctggaagatacg
ctcagagagcgcaacaagattgattgcctgaaagcgctggaacccagctctattgaagca
ggctctcttattgcagtgcgtcagcaggaaccgctgggccttgggcacgctatctggtgc
gcacgttcctttattggggatgatccgttcgccatcctgctgcccgatgatatcgtgcag
gctgcacccggcaagggctgcctgaagcagttggccgatgcgtataatgaaacaggcggt
agcgttgtggcggtaacagaagtgccgcgtgaacagacaaaccgttacggtattctggac
acaggcaaggatgatggccgccttgtggaagtaaaaggcctggttgaaaagccaaagccg
gaagatgcaccttccaatctgtccatcattggccgttatgtgctgacaccagaagttatg
ccttacctttccaagctggaaaaaggtgcaggtggtgaagtgcagcttacagatgccatg
gcaaaaaccattggtcaggtgcctttccacggcctgcgttatgaaggcacccgctatgat
tgcggcaacaagcttggcttccttgaagcgcaggtagcctttgctctggaacgtcctgat
cttgctgatggcgtgaaggaatttctgaaaaagtacacagataaaatctga

DBGET integrated database retrieval system