KEGG   Acetobacter pasteurianus IFO 3283-22: APA22_18940Help
Entry
APA22_18940       CDS       T01815                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
apq  Acetobacter pasteurianus IFO 3283-22
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:apq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    APA22_18940
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    APA22_18940
Enzymes [BR:apq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     APA22_18940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2061408..2062877
Genome map
AA seq 489 aa AA seqDB search
MSLPLSTLLAAVGLPILPENPEISAITADSRQIKPGTIFAALPGVKTDGRAFIAMAVQNG
AAAVLAPTDTQWPTGVPTCPLILAPNPRHALALMAAVLAGPQPQHLAAITGTNGKTSTAD
FIRQIWALQGFKAAAIGTLGLTGAEDTSISFPALTTPDPVALANGLAALTQAGFNHVALE
ASSHGLEQGRLDGLHLAAAGFTNLTRDHLDYHLTIEAYRTAKLKLFDTLLPQQAIAAANA
DMDAQTLQAIRALAARRNLRLRLVGEQGTTLRLMAHNALPAGQELSIEHNGHTSTVLLPI
PGRFQADNVLLAVALAAQDDAEIADILPLLPHLKGVRGRLERATVLPNGACAYVDYAHTP
DALARLLASLRPHARGKLVVVLGAGGDRDSGKRPLMGQEAIKGADIAIITDDNPRTENPA
SIRAEIKAGAPQALEIADRKQAIAEALSMLKADDVLVVAGKGHEQGQIIGNTILPFDDAA
VLRTLAGHP
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagccttcccctctccacccttcttgcggctgtagggctgcctatcctgcctgaaaat
cctgaaatttctgccattacagcggatagtcggcagataaagccgggcacaatttttgca
gctttgccgggcgttaaaaccgatggccgagcctttattgcaatggccgtgcaaaatggt
gcggctgcagtgttggctccaacagatacacagtggccaacaggtgtgcccacctgcccg
cttattctggcacccaacccgcgccacgcgctggcgcttatggcggctgttctggcaggg
cctcaaccacagcatctggcggccattaccggcacaaatggcaaaaccagtactgcggat
tttattcgccagatatgggcattacaggggtttaaagctgctgccattggcacacttggc
ctgaccggggcggaagatacgtccatttccttccccgcgcttacaacgccagatccggtt
gctcttgccaatgggctggctgcacttacccaagccgggtttaaccatgttgcactagaa
gcctcatcacacgggttggaacaagggcggctggacggtttgcaccttgcagccgcgggt
tttaccaatctgacgcgagatcatctggattatcatctgacgatcgaagcgtatcgcaca
gccaaactaaagctgtttgatactcttctgccacaacaggccattgccgcagccaatgcc
gatatggatgcgcaaacgcttcaggccatccgtgcccttgccgcccgccgaaacctgcgg
ctaaggctggttggagaacagggtacaacattacgccttatggcacacaatgctcttcct
gctggacaggaactgagcattgagcacaatggccacaccagcacggttctcctccctatt
ccgggacgctttcaggcagataacgtattgctggctgtagctcttgccgcgcaggatgat
gccgagattgcagatattctgccccttctgccgcacctcaaaggggttcgggggcggctg
gaacgtgcaaccgttctgcccaacggggcctgtgcgtatgtagattacgctcacacgcca
gatgcgctggcacggcttttggcatctttgcgcccccacgcacgcggcaagttggttgtt
gttctgggtgctgggggtgatcgtgatagtggcaaacgccctcttatgggtcaggaagcc
attaaaggtgcagatattgccattattacagatgacaacccgcgcacagaaaacccagcc
tccattcgtgcagagataaaagccggtgccccgcaggcgctggaaattgcagatagaaaa
caagcaatagcagaagctctttccatgcttaaagcagacgatgtactggttgtagccggc
aaaggccacgaacagggacagattataggcaataccattttaccgtttgatgatgccgcc
gtgttgcgcacactggcgggccatccatga

DBGET integrated database retrieval system