KEGG   Anaerococcus prevotii: Apre_0153Help
Entry
Apre_0153         CDS       T00964                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
apr  Anaerococcus prevotii
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
182439..183812
Genome map
AA seq 457 aa AA seqDB search
MIKFPKDFLFGSATSACQSEGGQVDGKSESIWDYWYKKEPYKFHDRIGPENTSNFYFDYK
ENVELLEKIGHNSFRTSISWARLIPKMDGKVNPKAVDFYENYFKEIKAKGIKLFVNLFHF
DMPMYLQEIGGWENKEVVERYVSYAKTCFKLFGKYADCFFTFNEPIVHVECGYLYQYHYP
CEVNPKKAVQVAYNTQLASALAIKALREIDKDKKIGIILNLTPAYPRSQNENDLKAAEIA
DLFAQKSFLDPSVLGVYPKKLVEIIKKEGLIPEYSKKELDIIKENTVDFLGVNYYQPLRV
MENPYTYKESAIFMPSKYYLSYDMPGKRMNPYRGWEIYPKAIYDIAINIKENYNNIDWMI
TENGMGVENEERFRKDGRIEDDYRIDFIKEHLTYLSKAIDEGANCKGYHLWTFIDNWSWL
NAYKNRYGLVEYKLETGQRLIKKSGLWFKKLSEEKGF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatttcctaaggatttcctatttggttctgcaacatccgcctgccaatcagaa
ggcggacaagttgatgggaaaagtgaaagtatttgggactattggtataagaaagaacct
tacaagtttcacgacagaataggaccagaaaatacatcgaatttttactttgattataag
gaaaatgtagaactcttagaaaaaataggccataattccttcaggacttctatttcttgg
gcaagacttatacctaaaatggacggtaaggtaaatcctaaggccgtggacttttacgaa
aattatttcaaggaaatcaaggccaaaggaatcaagcttttcgtaaatctgtttcacttc
gatatgcctatgtatcttcaagaaatagggggatgggaaaataaggaagttgtcgaaaga
tatgtatcctatgcaaagacttgctttaagctttttggtaaatacgccgactgttttttt
accttcaatgagccaatagttcatgtagaatgtggttatctataccaatatcactatcct
tgcgaagtaaatcccaaaaaggctgtccaagttgcttataatacccaacttgcttcagct
ttggctattaaagccctaagggagatagataaggataaaaaaattggcataatcttaaac
ttaaccccagcttatcctagaagccagaacgaaaacgacctaaaggcggctgagattgca
gacttatttgctcagaaatccttcctggacccatcagttctaggagtttatcctaaaaag
cttgtagaaattataaaaaaggaagggttaattccagaatatagcaaaaaagagcttgat
ataataaaagaaaataccgttgactttcttggagtaaattactaccaacccttgagggtt
atggaaaatccttatacatataaggaaagtgcaatctttatgccaagtaaatattatctt
tcctacgatatgccaggcaagaggatgaatccctacaggggctgggagatatatccaaaa
gccatctacgatatagccataaatatcaaggaaaattacaataatatcgactggatgatt
acggaaaatggcatgggggtagaaaacgaggaaagatttaggaaagacggaaggattgag
gacgattacagaattgattttatcaaagaacatctgacatatctaagtaaggctattgat
gagggggccaactgcaagggttaccatttgtggacctttatagacaactggtcttggctt
aatgcttacaaaaataggtatgggcttgtagaatataagctagaaactggacaaagatta
atcaaaaaatcaggtctttggtttaagaagcttagcgaagagaagggattctag

DBGET integrated database retrieval system