KEGG   Anaerococcus prevotii: Apre_0179Help
Entry
Apre_0179         CDS       T00964                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
apr  Anaerococcus prevotii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Apre_0179
   01230 Biosynthesis of amino acids
    Apre_0179
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apre_0179
  Energy metabolism
   00680 Methane metabolism
    Apre_0179
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Apre_0179
Enzymes [BR:apr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Apre_0179
Exosome [BR:apr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Apre_0179
  Exosomal proteins of melanoma cells
   Apre_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
206669..207358
Genome map
AA seq 229 aa AA seqDB search
MTKKLVLVRHGQSEWNLANKFTGWVDVNLSEKGEEEAKEAGRKIKEAGIMFDHAHTSVLT
RAIKTCNYALEYSGQMFVPVEKSWRLNERHYGALQGLNKAETAEKYGDEQVHIWRRSYDT
LPPELSEEEAKKQAELPMFKHLPADVVPTAENLKVTLERVLPYYFDHIAPQLLDGETVLV
AAHGNSLRALAKHLEKISDEDIMGLEIPTGQPLVYELDDELNVVKKYYL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaattagttctagtaagacacggtcaaagtgaatggaaccttgccaacaaa
tttacaggttgggttgacgtaaacctatctgaaaaaggggaagaagaagctaaagaagct
ggtagaaaaatcaaagaagcaggaataatgtttgaccatgctcacacatcagttctaaca
agagctatcaaaacttgtaattatgccctagaatactcaggacaaatgtttgttccagta
gaaaaatcttggagattaaacgaaagacactacggtgctcttcaaggactaaataaggct
gaaacagctgaaaaatatggagatgaacaagttcacatctggagaagaagctatgataca
ctcccaccagaactaagtgaagaagaagctaaaaaacaagctgaacttccaatgttcaaa
catcttccagctgacgttgttccaacagcagaaaacctaaaagtaactcttgagagagta
cttccttactacttcgaccacatcgctccacaactacttgatggagaaacagtcctagta
gcagctcacggaaatagcctaagagccctagcaaaacacctagagaaaatctcagacgaa
gacatcatgggccttgaaattccaacaggccaaccactagtttacgaactagatgatgag
ctaaacgtagttaaaaaatactatctataa

DBGET integrated database retrieval system