KEGG   Anaerococcus prevotii: Apre_0205Help
Entry
Apre_0205         CDS       T00964                                 

Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
apr  Anaerococcus prevotii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Apre_0205
Enzymes [BR:apr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Apre_0205
Exosome [BR:apr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Apre_0205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
231877..233865
Genome map
AA seq 662 aa AA seqDB search
MAKWEMLNIDPWLKDYENDINLRMESYERQKEKLLGDRKRLAEFANAHNYYGFHKTKTGW
IYREWAPNADGLYLIGDFNGWDRRSHPLTKINDEDWEIEIKGIRTLPHKSRIKVLVDANG
AIRDRIPLYATRVERNEDLDYAALIQNPRKKFKWEDDDFKIQKDDLLIYEAHIGMAGEEG
KVSSYKEFEKNVLPRIKKDGYNTIQLMAIAEHPYYGSFGYQVSNFFAPSSWYGENDELKS
LINACHKEGINVIMDLVHSHSVKNTAEGINEFDGTSFQFFHDGDEGNHPDWDSKLFDYKK
PGVCHFLLSNIKYWLEEYHFDGFRFDGVTSMIYKDHGRGEAFDSYSKYFSMNTDIEALNY
LQLANELIREIKKDAITIAEDMSGMPGMCLPIEYGGIGFDYRLAMGMPDFWEKSLEKRDE
DWDLSKMWYELSTHRPEEKRVSYVESHDQALVGSKTTIFRLADQEMYWNMRKDDHNMIID
RAIALHKMIRWITISMGADAYLNFMGNEFGHPEWIDFPREGNGYSYHYARRQWSLADSKD
LKYQFLNNFDNAMIGFSKENDQLANETYRLWIDNDRKIIAFRNKDIVYIFNFHPENSYES
FQLPIHDIGEFKVFMDTDEGRFGGFDRISHDFTYQTEKLSGTDYDGIKIYIPSRTGLALK
KI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtgggaaatgttaaatatagatccttggcttaaagattacgaaaatgatatt
aatttgaggatggaatcttacgaaaggcaaaaagaaaaacttttaggagatagaaaaaga
ctcgccgaatttgccaacgcacacaactattacggctttcacaagacaaaaactggctgg
atatatagggaatgggctcctaatgcagatggtctctatcttataggtgactttaatgga
tgggacagacgctcccatcctctcacaaaaataaatgacgaagattgggaaatcgagata
aaaggaatcaggactctccctcacaaatcaagaatcaaggtcttggtagatgcaaatgga
gccataagagataggattcctttgtatgctactagagttgagagaaacgaagatcttgac
tatgcagcccttatccaaaatcctaggaagaaattcaaatgggaagatgatgacttcaaa
atccaaaaagacgatcttttgatatatgaagcccatataggaatggctggagaagaaggc
aaggtttcttcttacaaggaatttgagaaaaatgtcctcccaagaattaaaaaggatgga
tacaatacaatccaacttatggctatagcagaacacccttactatgggtcttttggctat
caggtatcaaacttctttgcgccaagctcctggtatggagaaaatgacgaattaaagtca
ctaataaatgcctgccacaaggaaggcatcaatgtgataatggacttggttcattcccac
tctgtaaaaaatacagctgaaggcatcaatgaatttgatggaacaagcttccagttcttc
cacgatggggatgaaggaaatcaccctgattgggattccaaattatttgactacaagaaa
cctggagtctgtcattttcttctatcaaatataaaatattggctagaggaataccatttc
gatggatttagatttgatggtgtaacttctatgatttacaaagatcacggaagaggagaa
gccttcgactcatactctaaatacttctccatgaacacggatatagaagccctaaactac
ttgcagcttgctaatgaactcataagagaaattaaaaaagatgccataacaatagcagaa
gatatgagcggtatgccaggaatgtgtcttcctatagaatacggcggaataggctttgac
tataggcttgctatgggcatgccggatttctgggagaaatctctagaaaaacgagacgaa
gattgggacctatctaagatgtggtatgaactatcaactcacagaccagaagaaaagaga
gtatcctacgtagaaagccacgaccaggctctagtaggatcaaagactacaatatttagg
ctagccgatcaagaaatgtattggaatatgagaaaagatgaccataacatgattatcgat
agggccatagctcttcacaagatgataagatggattacaatatccatgggagctgatgct
tatcttaactttatgggtaacgaattcggccatcctgaatggattgactttccacgagag
ggaaacggatattcctaccattatgctagacgtcaatggtctctagctgattctaaagac
ttaaaatatcaatttttaaacaatttcgacaatgctatgataggattttctaaggaaaat
gatcaactagccaacgagacatacagattgtggatagataatgatagaaaaatcatagcc
tttagaaacaaggatatagtatatatctttaacttccacccagaaaactcctacgaatcc
ttccaattgccaatccacgatataggagaatttaaggtttttatggatacagacgaagga
agatttggagggtttgacaggataagtcacgactttacctatcagacagaaaagctttct
ggaactgactatgacggtatcaagatctacatcccatcaagaacaggtcttgccttaaag
aagatatga

DBGET integrated database retrieval system