KEGG   Anaerococcus prevotii: Apre_0237Help
Entry
Apre_0237         CDS       T00964                                 

Definition
glycoside hydrolase family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
apr  Anaerococcus prevotii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:apr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:apr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:apr00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
268268..270436
Genome map
AA seq 722 aa AA seqDB search
MGIIIEDRLYYVHAKGLSMILENRDGDLLLKHLGKSIKKYNFSNTIFEKDHAFSATQNPD
DRTYSYDTQRQAFGVHGFGDFRHPSIKIEHDNNELTHFKIKESQILDYEVDAKGLPNPHS
REETETLLLILEDEVSELELRIYYTAYEDSPTISTFTSLVNKSNQEVVIHRDLSAMFDMP
ASSYDIISLQGAYAREKTLRRRKVDQGMFSVFSNRGASGHSQTPAIILAETLANEDYGEA
WALQLMYSGNFQANVEKSQLNEVRMSIGIADDNFSWRLKPGESFDTPVALLTYSDKGLTK
LSQESQSFVQNHIMAKNFAYEKRPILINNWEATYFDFDKEKLSSLTDEASKLGIELFVLD
DGWFGNRFDDNRALGDWQVNEEKIGCKLSELISDVHKKGMKFGLWVEPEMISVDSDLYRK
HPDWAIQAPKRGHSYSRNQLVLNLANPEVVAYLKEILDDLLSNHDIDYIKWDYNRNITNI
GNGKDYLETMEQSHKYMLGFYDLVKYLTEKHSDVLFESCSGGGGRNDLGVMRYFPQVWAS
DNTDAISRLPIQYGSTFLYPTISMGAHVSASPNHQMKRVTPLKTRGHVAMMGNFGYELDL
SKLSEEEKNEIKEQVNLYKEIRPIIQFGRQYRLINPVEETNEVAVEFVKDDRILVTYVRK
LSTIEEIETTLKLKGLEEESIYRLHGTNKVYSGAELMYAGLTIVMNGGDFLSKQYYFTKI
EA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgggaattattattgaagataggctatactatgtacatgctaagggcctgtcgatgatt
ttagaaaatcgtgatggagatttgttacttaaacacctaggaaaaagtataaagaaatat
aatttttccaatactatatttgaaaaggaccacgctttttcagcaacacaaaatcccgat
gacaggacctatagttatgatacacaaaggcaagcttttggagtccatggctttggggat
tttaggcatccatcgattaaaattgagcatgacaacaatgaactaacacattttaaaata
aaagaaagccaaattttagattatgaagttgatgcgaaaggccttccaaatccacactct
agagaagagactgagaccttgcttttgattttggaggatgaagttagtgagcttgaatta
agaatctattacaccgcatacgaggattcaccaaccatatctacctttacaagcttggta
aataagtcgaaccaagaagtagttattcacagagatttatctgctatgtttgatatgcct
gcttcttcttatgatataataagcttacagggagcctacgctagagagaaaactctccgc
cgtcgaaaagtagatcagggaatgttttcggtattttcaaatcgtggggcttctggccac
tctcaaacaccagctataatattggcagaaactctagcaaatgaagattatggagaagct
tgggcccttcagctaatgtatagcgggaatttccaagcgaatgtagagaaaagccaatta
aatgaagtcaggatgtcgattggaattgctgacgacaatttctcctggagacttaagcca
ggtgaaagcttcgatactccagtggccctactaacttattcagataagggtcttacaaaa
ctaagccaggaaagccaaagctttgttcaaaatcatatcatggccaaaaactttgcttat
gagaaaagaccaatcctgattaacaactgggaggctacatactttgactttgataaggaa
aaattatctagcttaactgatgaagcaagtaagcttggaattgagcttttcgtccttgat
gatggctggtttggcaatcgttttgatgacaatagggctctgggagattggcaggtaaat
gaggaaaagattggttgtaagcttagtgaacttataagtgatgttcataaaaaggggatg
aaatttggcctatgggtcgagcctgagatgatttctgttgatagtgatctttataggaag
cacccagattgggctatccaagcgcctaagaggggccatagctattcaagaaatcaactt
gtccttaatttagcgaatccagaggttgtggcttatcttaaagaaatactagatgatctt
ttatcaaatcatgatatcgattatataaaatgggattacaatagaaatattacaaatatt
ggaaatggtaaagactatctcgaaacgatggagcaatcccacaaatatatgctaggattt
tatgatctagttaagtatttaacagaaaagcattcggatgtacttttcgaatcttgctca
ggaggtggtggaagaaacgatcttggagttatgagatatttcccacaagtttgggcaagc
gataatacagatgccataagtaggcttcctatccaatatggatcgactttcctttatcca
actatcagcatgggggcccatgtttcagcctcacctaatcatcagatgaagcgagtaact
cctcttaaaactaggggtcatgtcgctatgatgggcaattttggttatgaactagattta
agcaagctaagcgaggaagaaaaaaacgagataaaagagcaagtaaacttgtacaaagaa
atccgtcctataattcaatttggaagacaatacaggttaataaaccctgtcgaagagact
aatgaagttgctgtagaatttgtaaaggatgataggattttagtgacttatgtaaggaaa
ctttcaactatagaagagattgaaactacccttaagctaaaaggccttgaagaagaaagc
atatatcgtttgcatggaacaaataaggtctactcaggcgcagagcttatgtatgctggt
ctaactatagtaatgaatgggggagatttcctaagcaaacaatattactttactaaaatc
gaagcttaa

DBGET integrated database retrieval system