KEGG   Anaerococcus prevotii: Apre_0237Help
Entry
Apre_0237         CDS       T00964                                 

Definition
glycoside hydrolase family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
apr  Anaerococcus prevotii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Apre_0237
  Lipid metabolism
   00561 Glycerolipid metabolism
    Apre_0237
   00600 Sphingolipid metabolism
    Apre_0237
Enzymes [BR:apr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Apre_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
268268..270436
Genome map
AA seq 722 aa AA seqDB search
MGIIIEDRLYYVHAKGLSMILENRDGDLLLKHLGKSIKKYNFSNTIFEKDHAFSATQNPD
DRTYSYDTQRQAFGVHGFGDFRHPSIKIEHDNNELTHFKIKESQILDYEVDAKGLPNPHS
REETETLLLILEDEVSELELRIYYTAYEDSPTISTFTSLVNKSNQEVVIHRDLSAMFDMP
ASSYDIISLQGAYAREKTLRRRKVDQGMFSVFSNRGASGHSQTPAIILAETLANEDYGEA
WALQLMYSGNFQANVEKSQLNEVRMSIGIADDNFSWRLKPGESFDTPVALLTYSDKGLTK
LSQESQSFVQNHIMAKNFAYEKRPILINNWEATYFDFDKEKLSSLTDEASKLGIELFVLD
DGWFGNRFDDNRALGDWQVNEEKIGCKLSELISDVHKKGMKFGLWVEPEMISVDSDLYRK
HPDWAIQAPKRGHSYSRNQLVLNLANPEVVAYLKEILDDLLSNHDIDYIKWDYNRNITNI
GNGKDYLETMEQSHKYMLGFYDLVKYLTEKHSDVLFESCSGGGGRNDLGVMRYFPQVWAS
DNTDAISRLPIQYGSTFLYPTISMGAHVSASPNHQMKRVTPLKTRGHVAMMGNFGYELDL
SKLSEEEKNEIKEQVNLYKEIRPIIQFGRQYRLINPVEETNEVAVEFVKDDRILVTYVRK
LSTIEEIETTLKLKGLEEESIYRLHGTNKVYSGAELMYAGLTIVMNGGDFLSKQYYFTKI
EA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgggaattattattgaagataggctatactatgtacatgctaagggcctgtcgatgatt
ttagaaaatcgtgatggagatttgttacttaaacacctaggaaaaagtataaagaaatat
aatttttccaatactatatttgaaaaggaccacgctttttcagcaacacaaaatcccgat
gacaggacctatagttatgatacacaaaggcaagcttttggagtccatggctttggggat
tttaggcatccatcgattaaaattgagcatgacaacaatgaactaacacattttaaaata
aaagaaagccaaattttagattatgaagttgatgcgaaaggccttccaaatccacactct
agagaagagactgagaccttgcttttgattttggaggatgaagttagtgagcttgaatta
agaatctattacaccgcatacgaggattcaccaaccatatctacctttacaagcttggta
aataagtcgaaccaagaagtagttattcacagagatttatctgctatgtttgatatgcct
gcttcttcttatgatataataagcttacagggagcctacgctagagagaaaactctccgc
cgtcgaaaagtagatcagggaatgttttcggtattttcaaatcgtggggcttctggccac
tctcaaacaccagctataatattggcagaaactctagcaaatgaagattatggagaagct
tgggcccttcagctaatgtatagcgggaatttccaagcgaatgtagagaaaagccaatta
aatgaagtcaggatgtcgattggaattgctgacgacaatttctcctggagacttaagcca
ggtgaaagcttcgatactccagtggccctactaacttattcagataagggtcttacaaaa
ctaagccaggaaagccaaagctttgttcaaaatcatatcatggccaaaaactttgcttat
gagaaaagaccaatcctgattaacaactgggaggctacatactttgactttgataaggaa
aaattatctagcttaactgatgaagcaagtaagcttggaattgagcttttcgtccttgat
gatggctggtttggcaatcgttttgatgacaatagggctctgggagattggcaggtaaat
gaggaaaagattggttgtaagcttagtgaacttataagtgatgttcataaaaaggggatg
aaatttggcctatgggtcgagcctgagatgatttctgttgatagtgatctttataggaag
cacccagattgggctatccaagcgcctaagaggggccatagctattcaagaaatcaactt
gtccttaatttagcgaatccagaggttgtggcttatcttaaagaaatactagatgatctt
ttatcaaatcatgatatcgattatataaaatgggattacaatagaaatattacaaatatt
ggaaatggtaaagactatctcgaaacgatggagcaatcccacaaatatatgctaggattt
tatgatctagttaagtatttaacagaaaagcattcggatgtacttttcgaatcttgctca
ggaggtggtggaagaaacgatcttggagttatgagatatttcccacaagtttgggcaagc
gataatacagatgccataagtaggcttcctatccaatatggatcgactttcctttatcca
actatcagcatgggggcccatgtttcagcctcacctaatcatcagatgaagcgagtaact
cctcttaaaactaggggtcatgtcgctatgatgggcaattttggttatgaactagattta
agcaagctaagcgaggaagaaaaaaacgagataaaagagcaagtaaacttgtacaaagaa
atccgtcctataattcaatttggaagacaatacaggttaataaaccctgtcgaagagact
aatgaagttgctgtagaatttgtaaaggatgataggattttagtgacttatgtaaggaaa
ctttcaactatagaagagattgaaactacccttaagctaaaaggccttgaagaagaaagc
atatatcgtttgcatggaacaaataaggtctactcaggcgcagagcttatgtatgctggt
ctaactatagtaatgaatgggggagatttcctaagcaaacaatattactttactaaaatc
gaagcttaa

DBGET integrated database retrieval system