KEGG   Anaerococcus prevotii: Apre_0241Help
Entry
Apre_0241         CDS       T00964                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
apr  Anaerococcus prevotii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Apre_0241
Enzymes [BR:apr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Apre_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
273479..274930
Genome map
AA seq 483 aa AA seqDB search
MGIQNKTMLITYSDSLGKDLKDLKENLEKYFKDAVGGVHILPFFPSTGDRGFAPIDYDEV
DPKFGDWKDIKALGERYYLMFDFMINHISRKSKYYKDYQEKHEDSEYKDLFLNWDKFWPE
NRPSQADIDLIYKRKDRAPKQEIKFKDGLVENLWNTFGEEQIDLDVRTEVTMDFIKKNID
NLSKKGCDIIRLDAFAYAIKKLDTNDFFVEPEIWDLLDKIREMAVKNNVEILPEIHEHYK
IQFKIASHDYFIYDFALPMLTLYSLYSGKVDRLKNWLEKSPMKQFTTLDTHDGIGVVDVK
DIMTDDEIAFTTDQLYKVGANVNRKYSTAEYNNLDIYQINTTYYSALGDDDKKYFIARLI
QAFAPGIPQVYYVGFLAGKNDLKLLEETKEGRNINRHYYSNEEIAREVERPIVKALLMLF
KFRNRSEAFDLEGSISVENEGENIIIITRKNKDGSAVAKARIDLKNLTYKVTENDKEIEF
LNI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaattcaaaacaaaactatgcttattacttattcagatagtttaggcaaagattta
aaagatttaaaagaaaatttagaaaaatattttaaggatgccgtagggggtgtccatata
ttaccattctttccatcgacaggggataggggttttgctccaatcgattatgacgaggta
gatcctaagtttggagattggaaagatattaaggccttaggagaaagatactatcttatg
tttgattttatgatcaatcatatttctcgaaagtcaaagtactataaggactatcaggaa
aagcatgaagatagtgaatataaagatttattcctaaattgggataagttctggccagaa
aatcgtcctagccaagccgatatagatttaatctataaaagaaaagacagggctcccaag
caagaaattaaatttaaagatggattggttgaaaatctttggaatacatttggagaagag
cagattgacctagatgttagaactgaagtcactatggactttataaagaaaaatatagat
aatctttctaaaaagggctgtgacattataagacttgatgcctttgcttacgctatcaaa
aagctagatacaaatgacttttttgtagaacctgaaatatgggatttactagataagata
agagagatggcagttaaaaataatgtagaaatactgcctgaaattcacgaacattacaag
atacagtttaaaatagcaagtcatgattattttatatatgattttgccttgccgatgcta
actttatatagcctttattctggaaaggtagacagacttaaaaattggttagaaaaaagc
cctatgaaacaattcaccaccctagatactcacgatggtattggtgtggttgatgtaaaa
gatataatgaccgatgatgaaatagcctttactacagaccagctttataaggttggagcc
aatgttaataggaaatattcaacagcagaatataacaatctcgatatatatcagatcaat
actacttattattcagctcttggagatgatgataaaaaatattttatagctcgccttatc
caagcttttgctcctggaattcctcaggtttattatgtgggatttctagcggggaaaaac
gacttaaagcttcttgaagaaacgaaagaaggtcgaaatataaatcgtcattattattcc
aatgaggagatagctagggaagtagaaagacctatagtgaaagccctcctaatgcttttt
aaatttagaaataggtcagaagcttttgacctagaaggttcgatctcagtcgaaaatgag
ggagaaaacataataataattacccgtaagaataaagatggaagtgcagtagctaaagca
agaatagatcttaagaatctaacctataaagttactgaaaatgataaagaaatagaattt
ttaaatatatag

DBGET integrated database retrieval system