KEGG   Anaerococcus prevotii: Apre_0443Help
Entry
Apre_0443         CDS       T00964                                 

Definition
fructose-16-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
apr  Anaerococcus prevotii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:apr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:apr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:apr00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:apr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(499724..501625)
Genome map
AA seq 633 aa AA seqDB search
MDKNYLKLLKDIYPEKSDIKDELISLNSKLYLPKGTEYFFSDIHGESEAFLHLLRSASGN
IRDKIAKLFGDTLVKEDQDDLAELIYDPVHVLKDLFENDLLTEDYLTITIHRLINLFRFV
STKYPKAYVKSKFTGSYTNIIDELLYTNDSEFNKKEYYESLIANIVKYDSAREFIIALAR
LIQRVSVDKLHIVGDIYDRGPSPHIIMDELLTFPNVDIQWGNHDIAWMGAASGNEALIAA
CVANAISYNNFDMLEDGYGINLRPLYEFAIHTYKDDPCELFMPRVFDRNIYDNVSGEVAA
KMYKAISIIRFKLDGALIERNPEFNVDDRNFLKFVDFEKTTYKNVPLRDTNFPTIDPKDP
LKLTDAEQFIIDILKSDFIKGNRLNRHMRFLYKNGSMYKTENGSLLFHGCIPLTEDGKFQ
EIEIKGKKYSGRKLMDAFDKLARDAYFTNSIFAKDVMWYLINGRYSPIFGKSQYSYFENL
FVDDKDLKREVYNPYYKLSEKEEIVDMILDEFEITCERRRIINGHVPVKVKKGDSPIKAG
GKLYVIDGGISKPYQAKTGIAGYTLMFNSHHVALAEHKSYESITDKVSSYTPNIKEVEIL
LPRMLKKDTDEGRDIREKIEVLEKLLEMYDSAN
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaattatttgaaattattaaaagacatctatcccgaaaaatccgatataaaa
gacgagttaatttctcttaactccaagctctacctacccaagggcacggaatattttttc
tccgacatccatggagaaagcgaggccttccttcatctattaaggtctgcatcaggaaac
attagagataaaattgccaagctttttggtgataccctagtcaaagaagaccaagacgac
ttagcagagctgatttatgatccggtccacgttcttaaggacctttttgaaaacgattta
ttgacagaagactatctcaccataactatccacaggctaatcaacctctttaggttcgta
tctaccaaatacccaaaggcctacgtcaaaagcaaattcacaggctcatataccaatata
attgacgagcttctatataccaacgattctgagtttaacaagaaagaatactatgagtcc
cttatagcaaatattgtaaaatacgactctgctagggaatttatcatagcccttgcaaga
cttatccaaagagtatctgtagacaagctccatattgtcggagatatctacgacaggggc
ccttccccacacataatcatggacgaactactaacctttcctaatgtcgacatccaatgg
ggtaaccacgacatagcctggatgggagctgccagcggaaatgaggccttaatagctgcc
tgcgttgccaatgccatctcctacaacaacttcgatatgttagaagacggctacggaata
aacctaagacctctctatgaatttgctatccacacctacaaggacgacccatgcgagctt
ttcatgcctagggttttcgatagaaatatctacgacaatgtaagtggcgaagtagcagcc
aagatgtataaggcaatttctatcataagattcaaacttgacggagctcttatagaaaga
aatccagagttcaatgtggacgatagaaacttcctcaaattcgtcgattttgaaaaaacg
acctacaaaaatgtcccactcagggatactaactttcctaccatagatccaaaagaccca
cttaaactaacagatgccgaacaatttataatagatatcctaaaaagtgactttatcaaa
ggcaatagactaaaccgccacatgagatttctctacaaaaatggatcaatgtataagaca
gaaaacggctctctcctatttcatggctgcatccccctaactgaagacggaaaattccaa
gaaatagaaataaagggaaagaaatattccggaagaaagctcatggacgcctttgacaaa
ctcgctcgtgatgcttactttaccaattcaatcttcgccaaagacgtcatgtggtatcta
ataaatggcagatactctccaatctttggcaagagccaatactcctacttcgaaaatctc
ttcgtagacgataaggacctaaaaagagaagtctacaacccttactacaagctttctgag
aaggaagaaatagtagatatgatcctggatgaatttgagattacatgtgaaagaagaagg
ataataaatggccacgttccagttaaagtcaaaaaaggagatagtccaatcaaggcaggc
ggcaagctctatgtaatagatggtggaatatccaaaccttaccaagctaagaccgggata
gcaggttacaccttgatgtttaactcccaccacgtagccctagccgaacacaaaagctac
gaatctatcacagacaaggtatcaagctacaccccaaatataaaagaagtagaaatccta
cttccaagaatgttaaaaaaagacactgatgagggacgtgatataagagaaaaaattgaa
gttttggaaaagcttttggaaatgtacgatagtgcgaattga

DBGET integrated database retrieval system