KEGG   Anaerococcus prevotii: Apre_0491Help
Entry
Apre_0491         CDS       T00964                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
apr  Anaerococcus prevotii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Apre_0491
Enzymes [BR:apr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Apre_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
562920..563756
Genome map
AA seq 278 aa AA seqDB search
MERKCYAKVNLTLDSLSKRDDGYHEIDSIMVRINLFDKLIIKKNKENKFNYETNTPNICA
LEDNLIYKAWCLLKDRVDENGVDVTLIKNIPLAAGLAGGSTDAAEMIKGLDKLWDLGLTI
DERMCLGKKLGADIPFFFLESNARAQGIGEILTPFTNKLKMKLLLINDGTEISSAFIYKR
LADYGVIDTSEIIDKLRKGEKSAISGFRNVMEDVIFENFPHIREICSRLEDIGAEKALVS
GSGASVFGVFTDDYSLNLAYEKLSDKYKFVEKVELVDD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaaatgttatgctaaggttaatcttaccctcgatagcctatcgaaaagagat
gatggttatcacgaaatcgatagtattatggttaggattaatctgtttgataaattgatt
ataaagaaaaataaagaaaataaatttaattacgaaactaatacccctaatatctgtgcc
cttgaggataatcttatctataaggcttggtgtttacttaaagatagggtggacgaaaat
ggagtcgatgtgactttgatcaaaaatattcccctagcggcaggtcttgcgggaggctct
actgatgcagcagagatgatcaagggacttgataagctttgggatttgggtctaactatt
gatgagaggatgtgtcttggcaaaaagctaggagcagatattcctttcttcttcctagaa
tcaaatgccagagcccaagggatcggagagatactcacaccttttaccaacaagcttaag
atgaagcttcttctcataaatgacggaacagagatttcttccgcctttatctacaagaga
cttgctgattatggagtcatagatactagtgaaattattgataagcttcgcaagggagaa
aaatctgcaatctctggctttagaaatgtgatggaagatgtaatttttgaaaatttccct
catattagagaaatttgctcaaggcttgaagatataggcgcggaaaaggccctcgtaagt
ggatctggggctagtgtctttggagttttcactgatgattatagtctcaatcttgcctat
gagaagctttctgataagtataagttcgtagagaaagtggagttagtagatgactag

DBGET integrated database retrieval system