KEGG   Anaerococcus prevotii: Apre_0676Help
Entry
Apre_0676         CDS       T00964                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
apr  Anaerococcus prevotii
Pathway
apr00010  Glycolysis / Gluconeogenesis
apr00030  Pentose phosphate pathway
apr00051  Fructose and mannose metabolism
apr00052  Galactose metabolism
apr00680  Methane metabolism
apr01100  Metabolic pathways
apr01110  Biosynthesis of secondary metabolites
apr01120  Microbial metabolism in diverse environments
apr01130  Biosynthesis of antibiotics
apr01200  Carbon metabolism
apr01230  Biosynthesis of amino acids
apr03018  RNA degradation
Module
apr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apre_0676
   00030 Pentose phosphate pathway
    Apre_0676
   00051 Fructose and mannose metabolism
    Apre_0676
   00052 Galactose metabolism
    Apre_0676
  Energy metabolism
   00680 Methane metabolism
    Apre_0676
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Apre_0676
Enzymes [BR:apr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Apre_0676
Protein phosphatases and associated proteins [BR:apr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Apre_0676
Messenger RNA biogenesis [BR:apr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Apre_0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACV28715
JGI: Apre_0676
UniProt: C7RGV4
Position
773592..774551
Genome map
AA seq 319 aa AA seqDB search
MKTIGILTSGGDAPGMNSAIRAAVRTALNSGLRIKGIRNGYDGLMQGDIYEMNVSSVADI
IHKGGTILGTARSLEFETPEGQKRGAQILNDYGIEGLIVIGGDGSFKGAKALSDLGINTI
GIPGTIDNDMGYTDFTIGFFTAIETVTDAIGKLRDTSSSHGRAVVIEVMGRHCGDLALYS
GLAGGAESIIVPEHNFSISEIIDKMEHGRKRGKLHHLITLAEGVGDPYSLAKELEEKTGI
ETKVTILGHVQRGGSPSAVDRLLGSSMGSRAVRLLEEGKTNLAIGYVDGSIIEVSIDEAV
SKRSEFDEKLYELANSLSR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactataggaatacttacaagtggaggagatgctccaggtatgaattccgctata
agagctgcggtaagaacagcccttaacagtggtttacgtatcaaaggtataagaaacggt
tatgatggactgatgcaaggagatatctatgagatgaatgtatcatcagttgcagatatc
atccataagggtggtaccattctaggtactgcaagaagcttagagttcgaaacaccagaa
ggacaaaaaagaggtgcacaaatcctaaatgattatggcattgaaggcttaatcgtaata
ggaggagacggatccttcaagggagctaaagccctatctgatcttggaatcaacacaata
ggaatcccaggaacaatcgataatgacatgggctataccgactttacaatcggatttttc
acagcgattgaaactgtaacagatgctataggcaagctcagagatacatcaagttctcac
ggcagggctgtagttatcgaagttatgggtcgtcactgcggagacctcgctctttactca
ggacttgcaggaggagctgagtctattatagtaccagagcacaatttctctatcagtgaa
ataatcgataagatggaacacggtagaaaaagaggtaagcttcaccacctaatcacgctt
gctgaaggtgttggcgatccttattctcttgccaaagagctagaagagaagacaggaatc
gaaactaaggttacaatcttaggccacgtacaaagaggaggttcaccatctgcggtagac
agactcttaggttcatcaatgggatctcgtgctgttagactgcttgaagagggaaagaca
aaccttgcgatcggctatgtagatggaagcattatagaagttagcattgatgaagcagta
agcaaaagaagcgaattcgacgaaaaattatacgaacttgcaaattctttatcaagatag

DBGET integrated database retrieval system