KEGG   Anaerococcus prevotii: Apre_0758Help
Entry
Apre_0758         CDS       T00964                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
apr  Anaerococcus prevotii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Apre_0758
Enzymes [BR:apr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Apre_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
857999..860158
Genome map
AA seq 719 aa AA seqDB search
MKIKGIVTNIIFRNDENGYTIMAVDTSDSDITCVGTMPFFNEGDNVEMEGDIVYHDKYGE
QFKISSIRLVKPSSREAVVKFLSSGNLKGIGKKTARAIFDVFGKDSVDIVYNDPDKLLRV
DGIGKKKLEDIKLSAEDTRDSRRAIEYLQGLNLSYNLSMKIYKKYGESTVDVVKANPYKL
IEDIRGVGFTMADNIAINMQMDLTSKFRISAGVYYILNTEAEFNGHTCLKYNTLSQKSAN
LLKLEEGRIKEVINDDIIAGKLVLVEIEDINYIYSSNLLKAEKSVAMAIASKINEKYGFD
VKIDYDLSVFSDEQKIAIEKAFESMVLVITGGPGTGKTTIINAICKILSQNGLSYALTAP
TGRAAKRIKESTGEDAYTIHRLLGIRPDEVVAEFNEENPIDKDYIIVDETSMVDIFLMKN
LMAAIGDKTAIILVGDSDQLPSVGPGNVLKDILNTNVESVRLKKIFRQAGKSNIIVNAHR
INQGKYPILNEKDKDFFFIDTAASDFISVLTSLVKERLTKYYNFDPIKDIQILSPSKKTD
WGVVNINDHIQESINKEKNLLKINNKIFKLNDKVMQVRNNYDLKSINHEEDYDEGVYNGD
IGIIENIDKIDESLDVRFDDGRLIRYKKEDIKDLDLSYAITIHKSQGSEFPCVIIPMMQV
APMLLTRNLLYTGVTRARKIVILLGNKKILKTMVDNNKSNRRFTNLSYWIGEMEKVIDD
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaaaggcatagtcaccaacattatatttagaaacgacgagaatggatacaca
attatggctgtagacacttcagattctgatataacttgtgttgggactatgccctttttt
aatgagggcgataatgtcgagatggaaggagatatagtctatcacgacaagtatggtgaa
caattcaaaatatcttcaataagacttgtaaagccatcttctagggaagctgtcgtgaaa
tttctatcttctggaaacctaaaaggtattggcaaaaaaactgctagagctatctttgat
gtttttggcaaggattctgtggacattgtctataatgaccctgataagctactaagggta
gatggaattggcaagaaaaagcttgaagatataaagctttctgcagaagatacaagagac
tcgagaagggcaatcgaatacctccaaggactaaatttatcctataatctgtctatgaaa
atttataaaaaatacggtgaatcgacagtcgatgtagtaaaggctaatccctataaatta
atagaagatataaggggagtaggctttactatggccgacaacatagccataaatatgcag
atggaccttacttccaagtttaggatttctgcaggagtctactacatactaaatacagag
gcagaatttaacggtcatacttgtcttaaatacaatactctgtcccaaaaatctgccaat
cttttaaagcttgaagaagggagaataaaagaagtaattaatgatgatataattgctggt
aaattagttttggtagaaattgaggatatcaattatatctatagttctaatctccttaag
gcagaaaaatcagtagctatggctatagcgagtaaaattaatgaaaaatatggtttcgat
gtcaaaatcgactatgatctttctgtgttctctgatgaacaaaaaatagcaatagaaaaa
gcttttgaatccatggtccttgttataactggaggtccaggtacaggtaagactactata
ataaatgctatttgtaaaatactatcccaaaacggcctatcctatgccttaacagcaccg
actggaagggcggcaaagaggattaaggaatcgactggagaagatgcttacaccatacac
aggctattaggtataagacccgatgaagttgtagctgagttcaacgaggaaaatcccata
gataaggactatattatagtcgatgagaccagtatggtcgatatcttcctaatgaaaaat
ttgatggcagcaattggagataagactgcgataatcctcgttggagatagcgaccagtta
ccttcggttggtccgggcaatgttttgaaggatattttaaatacgaatgttgagtctgtt
agacttaagaaaatatttaggcaagcaggtaagtctaatatcattgttaatgcccacagg
ataaaccaaggaaaataccctatcttaaatgaaaaagataaggacttcttctttatcgat
acagctgcttccgacttcatttctgtacttacatccttggtgaaagaaagacttacaaaa
tattataatttcgatcccattaaggacatacaaatcctatccccgtccaagaagactgat
tggggagtggtcaatattaatgatcatatccaagaatctattaacaaggagaaaaatcta
ttaaaaatcaacaacaagattttcaaattaaatgacaaggtcatgcaagttagaaataac
tatgatcttaagtcaattaatcacgaagaggattatgacgaaggtgtctacaatggtgat
attggtataatcgaaaatattgataagattgatgagagtctcgatgtaagatttgatgat
ggtagactaatcaggtataagaaggaagatataaaagatttggacctatcatatgctatt
acaatccataagtcccagggatcagaatttccatgtgtcattattcctatgatgcaggta
gcaccgatgcttcttacgagaaatctcctttatacaggagtgacaagagctaggaaaatc
gtaattcttctaggaaataagaaaatcctaaagactatggtggacaataataaatccaac
aggagatttaccaacctttcctattggataggagaaatggagaaggtcattgatgattga

DBGET integrated database retrieval system