KEGG   Anaerococcus prevotii: Apre_0792Help
Entry
Apre_0792         CDS       T00964                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
apr  Anaerococcus prevotii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:apr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
893499..894104
Genome map
AA seq 201 aa AA seqDB search
MALYPESLQNLIEQFQKLPTIGRKSAERLAMAIVESDYKSVDDFSKSLTEVKDRIHACKI
CGNLTEDEVCDICKDITRNEEYLCIVEDVRNLIAIEKSHAYRGKYHVLGGLISPSDGLGP
DQLNIDKLLERIEKENIEEVILAISSTIEGETTVLFLTNLLSERNIKITKLAQGIPVGSN
LEYFDQLTLERALEDRREIVD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctttatatccagaatctttacaaaatctaatagagcaatttcaaaaactacctaca
attggaagaaaaagtgcagagagactcgctatggcgattgtagaatctgattataagtca
gtagacgatttttctaaaagccttactgaggtcaaagatagaattcatgcttgcaagatt
tgcgggaatcttactgaagatgaagtctgcgacatatgtaaagatataactagaaatgaa
gagtatttgtgtatagtagaagacgtgagaaatcttatagctatcgaaaaatcacatgcc
tacaggggaaagtaccacgttctagggggtcttatttctccttctgatgggctgggacct
gatcaactcaatattgataagttgctagaaagaattgaaaaagagaatattgaggaagta
attttagctatttcatcaactattgaaggggaaacaactgttttatttttaacgaattta
ctatccgaaagaaatatcaaaataacaaagcttgctcaaggaataccggttggctctaac
ctggaatactttgaccaattaactctagaaagagccttagaagataggagagagattgtt
gattaa

DBGET integrated database retrieval system