KEGG   Anaerococcus prevotii: Apre_0894Help
Entry
Apre_0894         CDS       T00964                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
apr  Anaerococcus prevotii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Apre_0894
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apre_0894
   00052 Galactose metabolism
    Apre_0894
   00500 Starch and sucrose metabolism
    Apre_0894
   00520 Amino sugar and nucleotide sugar metabolism
    Apre_0894
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Apre_0894
   00524 Butirosin and neomycin biosynthesis
    Apre_0894
Enzymes [BR:apr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Apre_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
965700..966602
Genome map
AA seq 300 aa AA seqDB search
MGKVIGIDIGGTKINACLIDDKGEILERKEVPTNANRGREVVLENIKSAIYDLSYKEAIA
VGIGTPGFIDSENGIVTFAGNIKGWTGLNLKEAVEEFVDVPVFVENDANIALIAEKWIGA
CKDYDNVVMITLGTGLGGAIYTKEAGLLSGSHFQGAELGHMILHAGGDPCTCGQKGCAES
YCAGTALTKGYKKLTGKELSGQAIFDLVETDNDARKVLEDYQSDLGYLLTSLRNIFDPDV
IVVGGGVIHAKDVFWDGMVSKYQEYCNKPSEVDIIPAKFLNNAGVIGAAKIAFERVNHGK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtaataggaattgatatcggtggaactaaaattaatgcatgtttaattgat
gataagggcgaaatattagaaagaaaagaagttcctaccaatgctaataggggtagggaa
gtagttttagaaaatataaaaagtgctatttatgacttatcatataaagaggctattgct
gttggtattggtactccaggctttattgattcagagaatgggattgtaacttttgcagga
aatattaagggatggacaggacttaacttaaaagaagcagttgaagaattcgttgacgtt
cctgtcttcgttgaaaatgacgctaatattgcattaatagcagaaaaatggataggagca
tgtaaggattacgataatgtcgttatgattaccctaggaacaggacttggcggtgctatt
tatacgaaagaagctggcctactatcaggatcacatttccaaggagctgaacttggtcat
atgattctacatgctggaggagatccttgtacttgtggacaaaagggatgtgccgaaagc
tactgtgctggaactgcactaactaaaggctacaaaaagcttacaggtaaagaattgagt
ggtcaagcaatctttgatttagtagaaactgataatgatgcaaggaaagtcttggaagac
taccaatctgacctagggtatcttttgacatcacttagaaatatttttgatcctgatgta
attgttgttggtggaggcgtaatccatgctaaggacgttttctgggacggcatggtatca
aaatatcaagaatactgcaataaacctagtgaagtcgacattattcctgccaaattttta
aataacgctggagtaattggtgcagctaagattgcctttgaaagagtaaatcatggaaaa
taa

DBGET integrated database retrieval system