KEGG   Anaerococcus prevotii: Apre_1434Help
Entry
Apre_1434         CDS       T00964                                 

Definition
diaminopropionate ammonia-lyase
Orthology
K01751  
diaminopropionate ammonia-lyase [EC:4.3.1.15]
Organism
apr  Anaerococcus prevotii
Brite
Enzymes [BR:apr01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.15  diaminopropionate ammonia-lyase
     Apre_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1554390..1555631)
Genome map
AA seq 413 aa AA seqDB search
MEEQYKIVLNDISKREKASLDFINEEVVNTAQKFHESFPDYEPTPLVRLSNLAKQFGVKD
IFVKDESYRFGLNAFKVLGGSFAIGKYIADKLGVDIEELPFEKMISDEVREKLGDITFVT
ATDGNHGRGVAWTANQLKQKCVVIMPDGSATERRDNIRALGAECDIMDGLNYDDCVRLAN
KNAEEKGWVMVQDTAWEGYEKIPTWIIEGYATLAKESNDQLKEAGLKPTHIFAQAGVGSF
ATGVTGYFSSVYEGEEKPFITIVEPEKANCNFITAKADDGKIHNVTGKMDTIMAGLACGE
PVTVGWPVLHSYADAFLSVPDKAAARGMRILGNPLKDDKKIISGESGAATMGPLSEILQR
KDLEEIKKDLKLDENSVILLISTEGDTDYAHYRRVVWDGIYPNEEEYTYSIQR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaacaatataagatagtactaaatgatattagtaaaagagaaaaggcttcccta
gattttatcaatgaggaagttgttaacactgcacaaaaatttcatgagagtttccctgat
tatgagccaactccactggtaagactaagtaacctcgccaagcaatttggtgtaaaggat
atcttcgtaaaagatgaatcttacagatttggtctaaatgccttcaaggtacttggtgga
tcatttgccattggaaaatacatagctgataagttgggagttgatatcgaagaattacca
tttgagaaaatgatttcagacgaagtgcgagaaaagcttggggatattaccttcgtaaca
gcgacagacggaaaccacggtaggggagtagcctggactgccaaccaacttaagcaaaaa
tgcgtggtaatcatgccagatggatcagctacagaaagacgtgacaacatcagagccttg
ggagcagaatgcgacataatggatggtctcaactacgatgactgcgttcgtcttgccaat
aagaacgctgaggaaaaaggttgggtaatggttcaagatacagcttgggaaggatacgag
aagattccaacatggatcatagaaggatatgcaacccttgctaaggaaagtaacgaccaa
ctaaaagaagcaggtcttaaaccaacacacatcttcgctcaagccggagtaggttctttt
gcaacaggagttaccggatatttctcttcagtatatgagggagaagaaaagccattcata
actatagtagagccagaaaaagcaaactgtaacttcatcacagctaaggcagatgatgga
aagatccacaatgttactggcaagatggatacaataatggcaggacttgcttgcggtgag
cctgtaacagtaggctggccagtacttcactcatatgcagatgccttcctatcagttcca
gataaggcagcagcaagaggaatgagaattctaggcaatcctttaaaggacgacaagaag
ataatctcaggagaaagtggagcagcaaccatgggtcctctctcagaaatcctccaaagg
aaagatttagaagagattaaaaaagacctaaagcttgacgaaaattcagtaatccttcta
atctcaacagaaggggatacagactacgctcactacagaagagtagtttgggatggaatc
tatccaaacgaagaagaatacacatactcaatacaaagataa

DBGET integrated database retrieval system