KEGG   Anaerococcus prevotii: Apre_1506Help
Entry
Apre_1506         CDS       T00964                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
apr  Anaerococcus prevotii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:apr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:apr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1641095..1642528)
Genome map
AA seq 477 aa AA seqDB search
MISFEDIISHISYIDYKKANDKAIKQVTNDSRKVNEGTIFVAIKGSLSDGHDYIASAIEK
GSSLIIHTADIKREEGISYIKVTDPRKTLAQISNLIYDFPSKKMDLVAVTGSNGKTTTSR
LISFLMGEIFGESASIGTNNAVVGDEIIPTSNTTPDITEVNRILAKCLDKNIHHLALEAS
SHGLDQKRLYGLDISYGIFTNLSEEHLDYHKTMDNYFKAKMILFENAKTTIANIDDPYGK
KAKELFSNTVTFAIDEKNADYRAEDIRKEDGKISFKIKGCEFVIRKIANYEIYNTLAACA
CLNQMGASMEEIAAAYKKFKGVKSRFEYIENDLGINIILDFAHTPRAYEALFESVPEGAK
KIAVFGINGDRNAHFRRLIGNACGKFDTFAVLTTDDPKFDDIDHINEEIIVGLDDYKQAY
VIKKDRTDAMEYAFRKARPGDYVFLLGKGEENFMKYHGNEKTPYSERETIKKALARI
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
ttgataagttttgaagatattatttcacatatatcttatatagattataaaaaagcaaat
gataaggctattaaacaagttacaaatgattcgagaaaggtaaatgaaggaactatattt
gtagccatcaagggctcacttagcgatgggcacgattatatagcatctgccatagaaaag
ggctcaagccttataattcatacagcagatataaaaagagaagaagggatctcctatatc
aaagtaactgatccaagaaaaactctcgcccaaatatctaatctcatctacgattttcca
tcaaagaaaatggaccttgtagctgttactggctcaaatggcaagacaactacatcaagg
cttatttcctttctcatgggagaaatctttggggaaagtgcaagtatagggacaaataac
gcagtggtaggagatgagattatccctacatcaaacacaactccagatatcacagaggta
aataggatccttgctaagtgtcttgataaaaacatccaccacctagctctcgaggcatca
agccatggccttgaccagaaaagactctacggactagatatttcctacggtatatttacc
aatctatccgaagagcacttggactatcacaagactatggacaattacttcaaggccaag
atgattttgtttgaaaatgccaagacgaccatagccaatatcgacgatccttatgggaaa
aaagctaaggaacttttctcaaatactgtaactttcgctatagacgagaaaaacgccgac
tacagggcggaagatattagaaaagaagatggaaaaatttcctttaagattaaaggctgt
gaatttgtcataagaaaaatcgcaaattatgaaatctacaacaccctagcagcttgcgcc
tgccttaaccaaatgggggcaagcatggaagaaatcgctgctgcctacaagaaatttaag
ggagttaagtcgagatttgaatatatagaaaatgatttgggcataaatatcatcctagac
ttcgcccatactcctcgtgcctacgaagctcttttcgagtcagtcccagaaggggccaag
aaaattgcagtctttggcataaatggggacaggaacgctcattttaggagacttatagga
aatgcttgtggtaagtttgacaccttcgcagtccttactacagatgatcccaagtttgat
gatatagaccacatcaacgaggagataatagtaggacttgatgattacaagcaagcttat
gtaataaaaaaagataggacagatgctatggaatacgcctttaggaaggctcgccctggt
gattatgtctttcttctaggcaagggtgaggagaattttatgaaatatcatggaaatgag
aagactccttacagcgagagagaaaccataaagaaggccttggctaggatatga

DBGET integrated database retrieval system