KEGG   Anaerococcus prevotii: Apre_1588Help
Entry
Apre_1588         CDS       T00964                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
apr  Anaerococcus prevotii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Apre_1588
   01230 Biosynthesis of amino acids
    Apre_1588
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apre_1588
   00030 Pentose phosphate pathway
    Apre_1588
   00051 Fructose and mannose metabolism
    Apre_1588
   00052 Galactose metabolism
    Apre_1588
  Energy metabolism
   00680 Methane metabolism
    Apre_1588
Enzymes [BR:apr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Apre_1588
Protein phosphatases and associated proteins [BR:apr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Apre_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1725261..1726481
Genome map
AA seq 406 aa AA seqDB search
MNCIIAQSGGPTSVINSSLAGVIQGALDNNFDNIYLSLHGIEGIINKDILEVDKKKFVRG
GVKEKLMARPSSILGSCRFKLPEDLNDDIYKKIFEFLLEKEINVFVYIGGNDSMDTVKKL
NAYILSNNIEGINVIGCPKTIDNDLNGMDHSPGFGSAAKYICQSLRTIRADVDIYDLESV
TIVEIMGRHAGWLAASSLLADFGYHKELVNLVYVPEESKSLKEIEEEVKEKLKTEKNLII
AMAEGFRDTDSYLDKPMFSNSDDGFNHPIVSGVAQRLADYLRDKLGVKSRAVELNIVQRT
SNHISKTDADEAFKLGYLALKLGLDKTNLIPVLRRKEGKSYEVFYTEVEPDLIANKEMKI
PESWLKDRKILREKITAYALPLIQGEVEQRYENGMPVFVELSDFTK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtatcatagcccagtcaggtgggcctaccagtgttatcaactcatctcttgct
ggagtcatccagggagctcttgataataatttcgacaatatttacctaagtcttcacgga
atcgagggaattattaacaaagatattctagaagtcgataagaaaaaatttgttagagga
ggggttaaggaaaagcttatggctcgtccttcttcaatcctaggatcttgcaggttcaag
cttccagaagaccttaatgatgatatctacaagaagattttcgaatttttgttagaaaaa
gaaatcaatgtttttgtctacataggcggaaacgactcaatggatacggtaaagaagcta
aacgcctatattttatctaataatattgaaggaatcaatgttataggatgtccaaagacc
atagacaacgacctcaatggtatggatcattccccaggttttggatctgctgctaaatac
atatgccaaagcctaaggactatcagggcagatgtcgatatctacgacctcgaatctgtt
acaatagtagaaatcatgggccgccacgcaggctggcttgctgcttcatccctcctggca
gacttcggctatcacaaagagcttgtcaatctagtctacgtcccagaagagagcaagtcc
ctaaaggaaattgaagaagaggtcaaggaaaagctaaagacagagaaaaacctcatcata
gccatggcagaaggcttccgtgatacagattcctaccttgataagcctatgttttccaat
agtgatgatggattcaaccaccctatagtaagcggtgttgcccaaagacttgcagattat
ctgagagataaactcggtgttaaatcaagggctgtggagctaaatatagtccaaagaaca
tccaaccacatctcaaaaacagatgcagacgaagcctttaagctaggttacttggcccta
aagctcggtcttgataagacaaatctaattccagttcttaggagaaaagaaggaaaatcc
tacgaagttttctacacagaagtagaaccagacctaatagccaacaaggaaatgaaaata
ccagaatcctggcttaaggatagaaaaatcctaagagaaaaaatcacagcctacgccctc
cctcttatccaaggagaagtagagcaaagatacgaaaatggcatgcctgtttttgttgag
ctttctgattttactaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system