KEGG   Anaerococcus prevotii: Apre_1626Help
Entry
Apre_1626         CDS       T00964                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
apr  Anaerococcus prevotii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Apre_1626
   00670 One carbon pool by folate
    Apre_1626
Enzymes [BR:apr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Apre_1626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1772703..1773197
Genome map
AA seq 164 aa AA seqDB search
MKIILAVDKNWGIGKDGQMLFHIRRDLKHFKSYTLGNICIMGRKTYESMGGALTHRENIV
LSRNKDYKAKDAKVFTDYRDVLSYVRERSEEVFVIGGEKIVEIFLEYCDEAIITKIYEKK
DADSFLHNFDQDDDWSLSEESDIMEENGVSFRYVRYRRKNHGKD
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattttggcagttgataaaaattggggcatcggcaaggatggacagatgctt
tttcatataagaagggaccttaagcattttaagtcctatactttaggaaatatctgtatc
atgggcagaaagacctacgagtccatgggaggcgcccttactcatagggaaaatatagtc
ctttctagaaataaggattataaggcaaaagatgcgaaggtatttaccgactatagggat
gtcctatcctatgtaagggaaaggtctgaggaagtctttgttataggcggggagaagata
gtagaaatcttcctagagtattgcgatgaggccatcattaccaagatttatgagaagaaa
gatgccgatagctttctccacaattttgaccaagatgacgactggtccctaagtgaagaa
tctgatattatggaagaaaatggggtatcttttagatatgtgagatataggaggaaaaat
catgggaaagattga

DBGET integrated database retrieval system