KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_041Help
Entry
CFPG_041          CDS       T00792                                 

Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
aps00260  Glycine, serine and threonine metabolism
aps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aps01100  Metabolic pathways
aps01110  Biosynthesis of secondary metabolites
aps01130  Biosynthesis of antibiotics
aps01230  Biosynthesis of amino acids
Module
aps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFPG_041
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFPG_041
Enzymes [BR:aps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CFPG_041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAG83304
UniProt: B6YQ32
Position
50805..51995
Genome map
AA seq 396 aa AA seqDB search
MKEKLTNNTFQVNEKGYYGKFGGAFIPEILHENINRLQKAYKSIIESQEFIEQYYKLLHD
YAGRPSPLYFAKRLSDKHKCRIYIKREDLNHTGSHKINNTLGQILLSRKMGKTRIIAETG
AGQHGVASATVCALMDMKCVVYMGKTDINRQNLNVRKMEMLGATVIPVTSGNMTLKDATN
EAIRDWCSNPDDTHYIIGSTVGPHPYPDMVARFQSIISKEIKSQLPEKENRNYPDYLIAC
IGGGSNAAGTIYEYLYDNRVKIILAEAAGQGIHSGHSAATIHLGKIGIIHGSKTLIMQTS
DGQIEEPYSISAGLDYPGIGPMHAHIAKQGRSEILAIDDNEALSAAMELTRLEGIIPALE
SAHALGIFQKKQFKTNDVIVVCLSGRGDKDMETYYK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaactgacgaataatacttttcaagttaatgagaagggctactatggtaaa
tttggtggtgctttcattcctgaaattcttcacgaaaacataaatagattacaaaaagca
tacaaatccatcatagaaagtcaagaattcatagaacaatattacaaacttttgcatgac
tatgcaggtcgaccctcacccctatattttgcaaaacgattatcagataaacacaagtgc
cgtatttatataaaaagagaggatctcaaccatacaggttcacataaaattaacaatact
ctcggacaaattttattgtctcgcaaaatgggtaaaacccgaataatagcagagacagga
gcaggccagcacggtgtagcttcagctacagtatgtgcattgatggatatgaagtgtgtt
gtatacatgggcaaaactgatataaatagacaaaatctaaatgtacggaaaatggaaatg
ttaggtgcaacagtcataccggttacaagcggcaacatgacactaaaagatgcaactaat
gaggccatacgcgattggtgttccaatcctgatgacacacattatattattggttcaaca
gtagggccacacccataccctgatatggtagcacgttttcaatcgattataagtaaagaa
attaaatcacaattaccagaaaaagaaaatcgtaactaccctgattatctcattgcatgt
atcggtggaggaagcaatgcagcaggtacaatctatgaatatctgtatgacaatcgtgta
aagattattcttgctgaagcagctggtcaaggaatacattctgggcactctgctgctact
attcacctgggcaaaattggaataatacatggttctaaaacattaataatgcaaacaagc
gatggccaaatagaagagccatattctatttccgcaggattagattatccaggaattggt
cctatgcatgcccatatagcaaagcaaggacgtagcgaaatactagccatcgatgataat
gaagctctatcggcagctatggaactaacacgtttggaaggaatcatcccagcattggaa
tctgctcatgctttgggtattttccaaaaaaagcaattcaaaacaaatgatgttattgtc
gtttgtctatctggaagaggtgataaggatatggagacttattataaatag

DBGET integrated database retrieval system