KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_226Help
Entry
CFPG_226          CDS       T00792                                 

Definition
folylpolyglutamate synthase
Orthology
K11754  
dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CFPG_226
Enzymes [BR:aps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     CFPG_226
    6.3.2.17  tetrahydrofolate synthase
     CFPG_226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
317628..318926
Genome map
AA seq 432 aa AA seqDB search
MDYEQTVEYIYNTSPMFQQIGGNAYKKGMENSFLIDKYLNHPHTKYKTIHIAGTNGKGST
SHLLASVLQESNYKVGLYTSPHLLDFRERIKINGSSINKNFVINFIAKYKFFFESIQPSF
FELTTAMAFSYFAEQAIDVAVIEVGLGGKLDCTNLITPVLSIITNISFDHTNLLGNTLTQ
IAKEKAGIIKPNIPVIIGKAEEKVKKVFLDLKRKAQNTKFIFAQEENFILSSKLLLSGYW
QLNTKEYPNLINELGGYAQIQNAVTTLCAIKILKRDVLNIPPQAVYRGFRYVTANTGIKG
RWQILQYAPKILLDIGHNIGGLEYVVQQLESEKYDKLHIIFGIVSDKDILSILQILPKNA
IYYFTQANIPRALNAQTLMNYAKSFGLRGRNYSTVTHAFASAKLSATKEDVIFIGGSTFV
VADALLAVQNFQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggactacgaacaaaccgttgagtacatttacaacacttctcctatgtttcaacaaata
ggaggtaatgcttacaagaaaggaatggaaaattctttcctaatcgataaatacctgaat
catccacacactaaatataaaactatccatatagcaggaacgaatgggaaagggtctact
tctcatctattagcatccgttttgcaagaatccaattataaagtaggactttacacctca
ccacatctattagatttcagagaaagaataaaaataaatggtagttctataaacaagaat
tttgtaattaattttatcgctaaatacaaatttttctttgaatccatccaaccttcattt
tttgaattaacaacagctatggctttttcctattttgcagaacaggcaatagatgttgct
gttattgaagttgggttaggtggaaaattagattgtaccaatctaattactcctgtctta
agtatcattactaatatcagttttgaccatactaatttattaggaaataccctaacccaa
attgcgaaagaaaaagcaggaataattaaacctaatattcctgtaattattggcaaagca
gaggagaaggtaaaaaaagtatttctagatttaaagcgtaaagcgcaaaatacaaaattt
atatttgcacaagaagaaaactttattctttcttctaaactcttgctctctggatattgg
caattaaatacaaaagaataccctaatttgatcaatgaactaggagggtatgctcaaata
caaaatgcagtaacaactctatgcgctatcaagattctgaaaagagatgttctaaacata
ccgccccaagctgtatatagaggatttcgttatgtgacagcaaacaccggaatcaaagga
cgttggcaaatattacaatacgctccaaaaattctgttggacataggacacaatattgga
ggattagaatatgttgtacaacaattagaatcagaaaaatatgacaaacttcatattatc
tttggtatagttagtgataaagatattttatctattctccaaattctacctaaaaatgct
atttactactttacacaggcaaatattcctcgcgcgttgaatgcacaaacattaatgaac
tatgccaaatctttcggtttaagaggaagaaattattccacagttactcatgcatttgcc
tctgcaaaactttctgccacgaaagaagatgttatttttataggtggaagtacatttgtt
gttgctgatgcattattagctgttcaaaattttcagtaa

DBGET integrated database retrieval system