KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_278Help
Entry
CFPG_278          CDS       T00792                                 

Definition
hydroxymethylbilane synthase/uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CFPG_278
Enzymes [BR:aps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CFPG_278
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CFPG_278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
387313..389361
Genome map
AA seq 682 aa AA seqDB search
MDTSKFSKGNLRVISRNSPLSLLQVKEVFSFFPNIDYQLITIESFGDKNKHVALFDISNV
SSFFLEEESISDFFTRELDEALIYNKADIAVHSAKDLPYPLPYDLELFALFQAMDKSDSL
ISRNNLTLEQLPPRARVGTSSQKRKTELLKIRPDLEVVSIRGNIEERIAKMDNGFIDALI
VATCALIRLGMEARIACILPFETHSLQGNLAIVGRKNDKNVKNLFCIQDIRKRYGKVSLV
GFGPGDPDLLTIGGYKALLSADIIFYDDLLNQEFLSRFLVEKVYVGKRKEVHRFHQGEIN
EFLYREAISGKRVVRLKGGDPMIFAHGREEIDFLQSRFVEVNIIPGISSGIAMSSYTHIP
LTYRGLASSVAFVTGHSEENIQVPTTDTLVYYMSGANLSVIARKLIAVGRREDLPVALIY
SVSLPNQKIWYSSLKELQYSIIKYPTPILLIIGEVVSFEKKETCKSQVLLTGTSNETSIR
YVNAIHTPLIKINKIENNKRLYTSIKEISVFDWIIFTSRYGVYYFFESLNEMKLDMKVLS
AVYIASVGKATSLELNKHGFYADIESESESAEGLINYFKVMRLTRKRILLPRSNRGLKYL
SELLEQLGNEVIDIPVYTNEINDKAEKVDLSFFQKIVFSSPSGVNAFIQLYRMLPSGIQM
IAKGKTTFSSLFSFFKIDSIRN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggatacttctaagttttcaaaaggaaatttaagggttattagtaggaacagtcctctt
tcattgcttcaagtgaaggaagtcttctcattttttccgaatattgattatcagttaata
actatagaatcgtttggagataagaataaacatgttgccttgtttgatatatctaatgta
tcttctttttttctagaagaagaaagcatttcagatttttttacgcgtgaattggatgag
gcattgatttataataaagcagatattgctgttcattcagccaaagatttgccttatcct
ttaccatatgatttagagttatttgctctatttcaagcaatggataagtctgattctttg
attagtagaaataatttgacattagaacagttacccccaagagcaagggttggtacgagt
tctcaaaaaagaaaaaccgaattgttgaagattcgtcctgatttggaagttgtaagtatt
cgtggaaatattgaggaacgcatagctaagatggataatggttttatagatgctttaatt
gtagctacttgtgcattaatacgattagggatggaagctcgcatagcttgtatacttcca
tttgaaacccattccttgcaagggaatttagctattgttggacggaaaaatgacaagaat
gttaaaaatttgttttgtatacaagatatacggaaaagatatgggaaagtaagtttagtt
ggatttggacctggtgatcctgatctgttgactattggaggatataaggctttgttatca
gctgatattattttttacgatgatttattaaatcaagagtttctttctcgatttttggta
gaaaaagtgtatgtaggtaaaagaaaagaagttcaccgatttcatcaaggtgagattaat
gaatttctttaccgggaagcaatttcaggaaagagagtagtgagattaaaggggggggat
ccaatgatttttgcacatgggcgtgaagagattgattttttacagagtcgttttgtagag
gtaaatattattccaggtatttcttctgggattgctatgtcttcttatacacatattccg
ttgacatatagaggattagcatcttctgttgcttttgtaactggacattcagaagaaaat
atacaagttcccactaccgatactttggtttattatatgagtggtgctaacctgtctgtg
attgcaagaaaattgatagctgtagggcgtagggaagatttgcctgtcgctttgatttat
agtgtttcgttaccaaatcagaaaatttggtattcttcattgaaagaactacagtattca
attattaaataccctactcctattttattgataataggtgaagtagtttcatttgaaaaa
aaagaaacatgtaaaagtcaagtattattaacagggacttccaatgaaactagtattcgt
tatgtaaatgcaattcatactcctttaattaagataaataagatagaaaataataaacgt
ttatatacttctataaaagagataagtgtttttgattggattatttttactagtcgttat
ggtgtctattatttttttgaatcattaaacgaaatgaagttagatatgaaagttttatct
gctgtttatatagcttcggttgggaaagcaacctctttggaattaaataaacatggattt
tatgctgacatagaatcagaaagtgaatcggcagaggggttgattaattatttcaaagtt
atgcgattaacaagaaagcggatattgcttcctcgttcgaatagaggcctgaaatatctt
tctgaattattggaacaacttgggaatgaagtaatagatattccagtatatactaatgaa
ataaatgataaagcagagaaagtagatttgtctttttttcaaaaaattgttttttcttct
ccttctggagtaaatgctttcatacaactttacagaatgttaccttctggaattcaaatg
attgcaaaaggaaaaactacgtttagttcattgtttagtttttttaaaatagattctatc
cgaaattga

DBGET integrated database retrieval system