KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_325Help
Entry
CFPG_325          CDS       T00792                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
aps00010  Glycolysis / Gluconeogenesis
aps00052  Galactose metabolism
aps00500  Starch and sucrose metabolism
aps00520  Amino sugar and nucleotide sugar metabolism
aps00521  Streptomycin biosynthesis
aps01100  Metabolic pathways
aps01110  Biosynthesis of secondary metabolites
aps01120  Microbial metabolism in diverse environments
aps01130  Biosynthesis of antibiotics
aps01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFPG_325
   00052 Galactose metabolism
    CFPG_325
   00500 Starch and sucrose metabolism
    CFPG_325
   00520 Amino sugar and nucleotide sugar metabolism
    CFPG_325
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CFPG_325
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CFPG_325
Enzymes [BR:aps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CFPG_325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: BAG83588
UniProt: B6YQW6
Position
452346..453308
Genome map
AA seq 320 aa AA seqDB search
MSALYVVGVDMGATNTAFGIVDARGTILFQDNIPTGNYSTGEEYAKVLSTAIKGLVTKNN
LNGEIKAIGIGAPNGNMHAGAIENAVNISWANGIVVPLAKMITEETDLPCRLTNDANAAA
FGEMVYGVAKGMKDFIMITLGTGVGSGIVANGSLVIGHDGMAGELGHMIVVRRNGRPCGC
GRNGCLEAYASATGVARTAREYLELNPGRYSLLREIVHRPLTSKDVFEAAEKRDELAIEV
FNFTGKILGETFCDFITFSSPQAIILFGGLSHASDYLLDPLQKAIDDNVMKAFAGKTRIL
LSQLKGAEAAILGASALAWE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactttatgtagttggtgtggatatgggagccactaatacagcttttggaata
gtagatgcacgaggaactattctttttcaagataatattcctacaggaaactactctaca
ggagaggagtatgctaaagttttaagcactgctattaagggactagtaaccaaaaacaat
ttgaatggtgaaattaaagctatcggtattggtgcaccaaatggtaatatgcatgcaggt
gctattgaaaatgccgttaatatttcttgggcaaatgggattgttgttcctttagcaaaa
atgattactgaagaaactgatttaccatgtaggttgactaatgatgctaatgctgcagca
tttggtgaaatggtctatggagtagccaagggaatgaaggattttattatgattacttta
ggtacaggtgtaggaagtggaatcgttgccaatggaagtttggtcattggtcatgatggt
atggcgggtgaattagggcatatgatagtggttagacgtaatggtcgtccttgtggatgt
ggtcgcaatggttgtttagaagcatacgcttcagccacaggagtggcgagaactgcacga
gagtatttggaattaaatcctggtagatattccttattaagagaaattgttcatcgtcct
cttacctccaaagacgtatttgaagcagcagaaaagagagatgaattagccattgaagtt
tttaattttacagggaaaattctgggagaaacattttgtgattttattactttttctagt
ccacaggctataatattgtttggaggattatctcatgcaagtgattatttattagaccct
ttgcaaaaggcaattgatgacaacgtgatgaaagcatttgctggtaaaacgagaatactc
ctttctcaacttaaaggagcggaagcagccatattgggagcaagtgctttggcatgggaa
tag

DBGET integrated database retrieval system