KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_325Help
Entry
CFPG_325          CDS       T00792                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CFPG_325
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFPG_325
   00052 Galactose metabolism
    CFPG_325
   00500 Starch and sucrose metabolism
    CFPG_325
   00520 Amino sugar and nucleotide sugar metabolism
    CFPG_325
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CFPG_325
   00524 Butirosin and neomycin biosynthesis
    CFPG_325
Enzymes [BR:aps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CFPG_325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
452346..453308
Genome map
AA seq 320 aa AA seqDB search
MSALYVVGVDMGATNTAFGIVDARGTILFQDNIPTGNYSTGEEYAKVLSTAIKGLVTKNN
LNGEIKAIGIGAPNGNMHAGAIENAVNISWANGIVVPLAKMITEETDLPCRLTNDANAAA
FGEMVYGVAKGMKDFIMITLGTGVGSGIVANGSLVIGHDGMAGELGHMIVVRRNGRPCGC
GRNGCLEAYASATGVARTAREYLELNPGRYSLLREIVHRPLTSKDVFEAAEKRDELAIEV
FNFTGKILGETFCDFITFSSPQAIILFGGLSHASDYLLDPLQKAIDDNVMKAFAGKTRIL
LSQLKGAEAAILGASALAWE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactttatgtagttggtgtggatatgggagccactaatacagcttttggaata
gtagatgcacgaggaactattctttttcaagataatattcctacaggaaactactctaca
ggagaggagtatgctaaagttttaagcactgctattaagggactagtaaccaaaaacaat
ttgaatggtgaaattaaagctatcggtattggtgcaccaaatggtaatatgcatgcaggt
gctattgaaaatgccgttaatatttcttgggcaaatgggattgttgttcctttagcaaaa
atgattactgaagaaactgatttaccatgtaggttgactaatgatgctaatgctgcagca
tttggtgaaatggtctatggagtagccaagggaatgaaggattttattatgattacttta
ggtacaggtgtaggaagtggaatcgttgccaatggaagtttggtcattggtcatgatggt
atggcgggtgaattagggcatatgatagtggttagacgtaatggtcgtccttgtggatgt
ggtcgcaatggttgtttagaagcatacgcttcagccacaggagtggcgagaactgcacga
gagtatttggaattaaatcctggtagatattccttattaagagaaattgttcatcgtcct
cttacctccaaagacgtatttgaagcagcagaaaagagagatgaattagccattgaagtt
tttaattttacagggaaaattctgggagaaacattttgtgattttattactttttctagt
ccacaggctataatattgtttggaggattatctcatgcaagtgattatttattagaccct
ttgcaaaaggcaattgatgacaacgtgatgaaagcatttgctggtaaaacgagaatactc
ctttctcaacttaaaggagcggaagcagccatattgggagcaagtgctttggcatgggaa
tag

DBGET integrated database retrieval system