KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_391Help
Entry
CFPG_391          CDS       T00792                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
aps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aps01100  Metabolic pathways
aps01110  Biosynthesis of secondary metabolites
aps01130  Biosynthesis of antibiotics
aps01230  Biosynthesis of amino acids
Module
aps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFPG_391
Enzymes [BR:aps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CFPG_391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: BAG83654
UniProt: B6YR32
Position
553248..554036
Genome map
AA seq 262 aa AA seqDB search
MKLNILETICANKQLEVARQKEILSFDILKKHLETYPYKGISFKQSLVQSNTGIIAEFKR
CSPSKGWINQNADIEAIVRGYEITGAATISVLTDEMYFGATPNDFSTACRIITKIPILRK
DFIIDEYQIYQSKAMGADVILLIASLLSTEESFRFTEIAHQLDMEVLLEIHNKEELDYIQ
SNVDVIGINNRDLRTFVTDIQYTIELACQIPKEYVKISESGLSQPQTVSILKKEGFNGFL
IGEYFMKTENPVQALKEFVDQL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaatattctcgaaactatttgtgctaataaacagcttgaggttgctcgacaa
aaagaaatactttcttttgatattttaaagaaacacttggaaacttatccttacaaaggg
atctctttcaaacaatcattagtgcaatccaatacaggtattattgctgaattcaaacga
tgttcgccatctaaaggatggataaatcaaaatgctgatattgaagcaattgtacgggga
tatgaaataactggagctgctactatttcggtacttactgatgaaatgtatttcggagct
actccgaatgatttttctacagcttgtcgtatcattacaaaaatacctattctgcgaaaa
gattttattatagatgaatatcaaatttaccaatctaaagcaatgggggcagatgtaatt
cttttgatagcctctctcctttccactgaagagtcattccgatttacagaaatagctcat
caactagatatggaagttttattagaaatacacaataaagaagaattggattatattcaa
tccaatgtagatgtaataggaatcaacaatcgtgatttgagaacatttgttacagacatt
caatatactattgaattagcatgccaaataccaaaagaatacgtaaaaatttcagaaagt
ggactttcacaaccacaaactgtttccattttgaaaaaagaaggatttaacggatttctt
ataggagaatatttcatgaaaacagaaaatcctgtacaagcactaaaagaatttgttgac
caattatga

DBGET integrated database retrieval system