KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_391Help
Entry
CFPG_391          CDS       T00792                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CFPG_391
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFPG_391
Enzymes [BR:aps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CFPG_391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553248..554036
Genome map
AA seq 262 aa AA seqDB search
MKLNILETICANKQLEVARQKEILSFDILKKHLETYPYKGISFKQSLVQSNTGIIAEFKR
CSPSKGWINQNADIEAIVRGYEITGAATISVLTDEMYFGATPNDFSTACRIITKIPILRK
DFIIDEYQIYQSKAMGADVILLIASLLSTEESFRFTEIAHQLDMEVLLEIHNKEELDYIQ
SNVDVIGINNRDLRTFVTDIQYTIELACQIPKEYVKISESGLSQPQTVSILKKEGFNGFL
IGEYFMKTENPVQALKEFVDQL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaatattctcgaaactatttgtgctaataaacagcttgaggttgctcgacaa
aaagaaatactttcttttgatattttaaagaaacacttggaaacttatccttacaaaggg
atctctttcaaacaatcattagtgcaatccaatacaggtattattgctgaattcaaacga
tgttcgccatctaaaggatggataaatcaaaatgctgatattgaagcaattgtacgggga
tatgaaataactggagctgctactatttcggtacttactgatgaaatgtatttcggagct
actccgaatgatttttctacagcttgtcgtatcattacaaaaatacctattctgcgaaaa
gattttattatagatgaatatcaaatttaccaatctaaagcaatgggggcagatgtaatt
cttttgatagcctctctcctttccactgaagagtcattccgatttacagaaatagctcat
caactagatatggaagttttattagaaatacacaataaagaagaattggattatattcaa
tccaatgtagatgtaataggaatcaacaatcgtgatttgagaacatttgttacagacatt
caatatactattgaattagcatgccaaataccaaaagaatacgtaaaaatttcagaaagt
ggactttcacaaccacaaactgtttccattttgaaaaaagaaggatttaacggatttctt
ataggagaatatttcatgaaaacagaaaatcctgtacaagcactaaaagaatttgttgac
caattatga

DBGET integrated database retrieval system