KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_393Help
Entry
CFPG_393          CDS       T00792                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CFPG_393 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFPG_393 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFPG_393 (trpA)
Enzymes [BR:aps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CFPG_393 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
554663..555433
Genome map
AA seq 256 aa AA seqDB search
MNKITTLFQNRQRNIVSIYFTAGFPQLNDTIEIIKELQINGIDMIEVGVPFSDPIADGKV
IQASSYKAIQNGMNLKILFKQLEAIKSKIQIPLIIMSYLNPIIQYGFENFCEDCHKIDIS
GIIIPDLPFEEYINEYKFITDAYDLKMIMLISPKTSEERIRLIDSNVEGFIYMVSSAATT
GIQESFDEQKQEYFRRINSMKLRNPRLIGFGISNKETLTVALENASGVIIGSKFVSLLAE
ENNPKKAVQKLLAELK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaataacgactctatttcaaaataggcagcgaaatattgtctctatttatttc
actgctggatttcctcaactaaacgacactatagaaatcattaaagaattacaaataaat
ggtattgatatgatagaagtaggcgtcccgttttctgatccgatagcagatggtaaggta
attcaagcaagtagttataaagcaattcaaaatggaatgaatctgaaaatccttttcaag
caattagaagctattaagagtaaaattcaaattccattgattataatgagttatttaaat
ccaattatacagtatggttttgaaaatttttgcgaagattgccacaaaatagatatttca
ggtataatcattccagatttgccttttgaagaatatattaatgaatataaattcattaca
gatgcttatgatttgaaaatgattatgctaatatctccaaaaacctctgaagaacgaatt
cgtcttatcgacagcaatgtggaaggattcatttatatggtctccagtgcggcaacaact
ggaatacaagaaagttttgatgagcaaaaacaggaatactttcgtagaattaacagtatg
aaattacgaaatccgcgattgattggctttggaatttcaaataaagaaacgttaactgtt
gctcttgaaaacgcttctggagtaattattgggagtaaatttgtgagcctattagcggaa
gaaaataatcccaaaaaagcagtacagaaacttcttgcagaattaaaataa

DBGET integrated database retrieval system