KEGG   Candidatus Azobacteroides pseudotrichonymphae: CFPG_397Help
Entry
CFPG_397          CDS       T00792                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aps03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
562651..563241
Genome map
AA seq 196 aa AA seqDB search
MLDFIKGEIVELIPDSVIIETGNIGYMLFISLNTYFSLTKIKSCKLYIYEVIREETHQLF
GFIDKKERQLFTHLISVPGVGANIARMVLSSLSVCELEEIIFSGNVSALQALKGIGNKTA
ERIIIDLKDKVKPDNIPSSDTIITNISSNITKEAITALITLGFSQSASQKVVNKIVSNNS
SSTTIEQIIKKALKLL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgttagattttattaaaggtgaaattgttgaattaattcctgattcagtaataattgaa
acaggtaatataggttatatgcttttcatttcattaaatacctatttttcacttactaag
ataaaaagctgtaagctatatatttatgaagttatcagagaggaaactcatcaacttttt
ggttttatagacaaaaaagagagacaattatttactcatcttatttcagtacctggtgta
ggagcaaatattgcacgcatggttttatcatccttatctgtttgtgaattggaagaaatt
attttttctgggaatgtatcggctttgcaggcactaaaaggtattggaaacaaaactgct
gaaagaattatcattgatttaaaagataaagtaaaacctgacaatattccttctagtgat
actattatcacaaacatttcttctaatattactaaagaagctattactgcattgattacg
ttgggattcagtcaatcggcctcacaaaaagtggtcaataaaattgtaagtaataattca
agttctacaacaatagaacaaatcattaaaaaagcgttaaaattattgtaa

DBGET integrated database retrieval system