KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_416Help
Entry
CFPG_416          CDS       T00792                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFPG_416
Enzymes [BR:aps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CFPG_416
Exosome [BR:aps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFPG_416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(584085..586133)
Genome map
AA seq 682 aa AA seqDB search
MESLELIKNDAWLNPYQQAIKGRYEYFLQREKELTNNHKMTLSNFASGYLYFGLHNASSG
WVFREWAPNATKIYLIGNFNNWQEKEEFQLKRLDNETWELHLPKDTLRHKDLYKLKLYWE
NGAGERIPAWAKRVVQDKETYIFNAQVWEPNNPYQFKNKSFQAKTTPLLIYECHIGMATD
KERVGTYQEFIQNVLPRIKTNGYNAIQIMAIQEHPFYGSFGYQVSNFFAASSRFGTPDDL
KELIDTAHSMNIAVIMDIVHSHAAKNEVEGLGRFDGSYNQYFHQGERREHPVWNSLCFDY
GRNEVLHFLLSNCKFWLEEYHFDGFRFDGVTSMLYKSHGIGETITSYNDYFNLNQDGDAI
CYLTLANRLIHTINKHAITIAEEVSGMPGLAVKINQGGYGFDYRLAMNIPDYWIKLIKEK
KDQDWHPLNIWEELTNRRTDEKTISYVESHDQALVGDKTIIFRLIDAEMYNGMSEIHKVD
SLLIDRGIALHKIIRLVTASTICGGYLNFMGNEFGHPEWIDFPRQGNSWSYKYARRQWHL
ADDNNLKYKYLYNFDKDMILLINSIEDFQATPLQKIWDSEGDQVLAFCRNDLVFVFNFNP
VQSFTDYGFLVAPCKYQTILNTDSPQFGGFGLIDDKIEHFTTYDKLYEKEKKEWLKLYLP
ARTAMVLKRIKWNKTKLFRSKK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgcttgaacttattaaaaacgatgcttggcttaatccctatcagcaagcaata
aaaggtcgttatgagtatttccttcaaagagaaaaggaattaacaaacaatcataaaatg
actcttagtaattttgcatcgggatatctatactttggattacataatgcgtcttcagga
tgggtatttagagaatgggcaccaaatgctacaaaaatttatctaataggcaatttcaat
aactggcaagaaaaagaagagtttcaactcaaaagattagataatgaaacatgggagctt
catttacctaaagatactctccgacacaaagatctttataaattaaaattatactgggaa
aatggagcaggtgaacgtattccagcatgggcaaaacgcgttgtccaagataaagaaacc
tacattttcaatgctcaagtatgggaacctaataatccttatcaatttaaaaataagtcc
ttccaagctaagactactcctttgttaatttacgaatgtcatatcggtatggcaactgat
aaagaaagagttggaacttatcaagaatttatacaaaatgttcttccacgtataaaaaca
aatggatacaacgctattcaaattatggcaatacaagaacatcctttttatggttcattt
ggctatcaagtgtcaaatttttttgctgcttcttcacgctttggaactccagatgactta
aaagaactgattgacacggctcattccatgaatatagcagtaattatggatattgttcat
tctcatgcagcaaaaaatgaagtggaaggattagggcgatttgatggctcttacaaccaa
tatttccatcaaggagaaagaagagaacatcctgtgtggaattctctttgtttcgattat
ggaaggaatgaagttttacatttcctattatccaactgcaagttttggttagaagaatat
cattttgatggatttcgattcgatggagtaacttccatgttgtacaaaagtcacggaata
ggagaaacaattactagttataatgattattttaatctcaaccaagatggtgatgccatt
tgttacctcacacttgccaatcgtttaatacatacaatcaacaaacatgctattaccatt
gctgaagaagtaagcggaatgcctggcttagcagttaaaataaatcaaggcggatatgga
tttgactatcgtttagcaatgaatattccggattattggattaagttaatcaaagagaag
aaagaccaagattggcatcctttaaatatatgggaggaattaactaatcgccggacagat
gaaaaaactattagttacgtagaaagtcatgaccaggcattagtaggagacaaaacaata
atttttagactgatagatgcagaaatgtataatggaatgagtgaaatacataaagtagat
tctttgttgatagatagaggcatagctttacataaaataatccgattagttacggcatct
actatatgcggaggctacctgaattttatgggaaatgaatttggacatccagagtggata
gatttccctcgtcaaggtaatagttggtcatacaaatatgcacgcagacaatggcatttg
gctgatgataacaacttaaaatataagtatctatataattttgataaagacatgatcctt
ctaattaacagtatagaagactttcaggcaactccacttcaaaaaatatgggatagtgaa
ggagatcaagtattagctttctgtcgtaacgatttagttttcgtattcaattttaatcct
gttcaatcatttacagattatggttttttagtagcaccatgtaaatatcaaacaatcctt
aatactgattctcctcaattcggaggttttggattaatagatgataaaattgaacatttc
accacttatgacaaactctatgaaaaagaaaaaaaagaatggttaaaactatatttgcca
gcaagaacggctatggtgcttaaacgcataaagtggaataaaaccaaattatttaggagt
aaaaaatag

DBGET integrated database retrieval system